Dbfetch

ID   AK135076; SV 1; linear; mRNA; HTC; MUS; 3161 BP.
XX
AC   AK135076;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus adult male olfactory brain cDNA, RIKEN full-length enriched
DE   library, clone:6430572D22 product:G protein-coupled receptor kinase 5, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3161
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; cbfa1bebb27ac85798ad88ab7515536b.
DR   Ensembl-Gn; ENSMUSG00000003228; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025299; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0025275; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0025244; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025270; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025030; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025713; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024495; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0025010; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0025142; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0025103; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0025228; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025136; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025771; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024243; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024565; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000003313; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052292; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0052299; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0052248; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052245; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051978; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052730; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052132; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0051924; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0052028; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0051986; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0052146; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051980; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052864; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051737; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051259; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=6430572D22
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3161
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="6430572D22"
FT                   /tissue_type="olfactory brain"
FT                   /db_xref="taxon:10090"
FT   CDS             834..2606
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="G protein-coupled receptor kinase 5 (MGD|MGI:109161
FT                   GB|NM_018869, evidence: BLASTN, 99%, match=2223)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3TST4"
FT                   /db_xref="InterPro:IPR000239"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:109161"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TST4"
FT                   /protein_id="BAE22411.1"
FT                   /translation="MELENIVANTVLLKAREGGGGKRKGKSKKWKEILKFPHISQCEDL
FT                   RRTIDRDYYSLCDKQPIGRLLFRQFCETRPGLECYIQFLDLVAEYEITPDENLGAKGKE
FT                   IMTKYLTPKSPVFIAQVGQDLVSQTEKKLLQSPCKELFSACAQSVHDYLKGDPFHEYLD
FT                   SMYFDRFLQWKWLERQPVTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKRLEKKRI
FT                   KKRKGESMALNEKQILEKVNSQFVVNLAYAYETKDALCLVLTIMNGGDLKFHIYNMGNP
FT                   GFEEERALFYAAEILCGLEDLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEGD
FT                   LIRGRVGTVGYMAPEVLNNQRYGLSPDYWGLGCLIYEMIEGQSPFRGRKEKVKREEVDR
FT                   RVLETEEVYSSKFSEEAKSICNMLLTKDSKQRLGCQEEGAAEVKRHPFFRNMNFKRLEA
FT                   GMLDPPFVPDPRAVYCKDVLDIEQFSTVKGVNLDHTDDDFYSKFSTGSVPIPWQNEMIE
FT                   TECFKELNVFGPNGTLSPDLNRSQPPEPPKKGLFHRLFRRQHQSNSKSSPTPKTSCNHR
FT                   INSNHINSNSTGSS"
FT   regulatory      3134..3139
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      3161
FT                   /note="putative"
XX
SQ   Sequence 3161 BP; 804 A; 769 C; 900 G; 688 T; 0 other;
     gtgcggccgc caggtcgccc cgggctggcc gaaccccttg ctgcccggaa acaaagtgca        60
     cctttgtcag agacctggcg cgtgtgagcg gcagacggcg ggccgcgcgg aaccccagga       120
     gcgcgccttc gctcgggtct cagctcactc ctgggcctcc cacagcagcg ttctgccgcc       180
     ttggcttgtg ctttccgctt tctcggatct tggcgggaca ggaaagggac tctgcgctcc       240
     aggagtgggg gtttcgtttt ggctgagtcg tttttgactc ctgccggcga ggctgggccg       300
     cctgggctca gcgccatacc ggcagcagtc ctgctccaca gtcccggtgc aatagagccc       360
     tcgccccgtc agacgcggga ctacaattcc cagcactcct cgcgttcaga gcgcgcggtg       420
     ggagttgcct ccgggcagac gcctgcgcgc tgcagcggct cgagcctgga gtaccacacc       480
     cccgggaggg gaacgagggg aggctgaagc atccgaagca ttaaagcatc cgagggagcc       540
     ggaggggagg agaatggagt gacagagacg cgcggagggt ggggggtggg ggggaaagtg       600
     ttgagggagg ggggaggggg gacacagagg gaggaagaag cggcggcggc gtctcttcgg       660
     tgcagagggg gaaactccgc gggctccgag aaagaataat gcggtagcag gcaggctgct       720
     tgctctgggg ttaggcagca gcggcggcag ctcgagcagt ggcagcggca gcggcatcac       780
     cccagacgct gacagcacag ccggccggct ccctcgctga ctgccgactg tcaatggagc       840
     tggaaaacat cgtggccaac acggtcttgc tgaaagcccg ggaagggggt ggaggaaagc       900
     gcaaagggaa aagcaagaag tggaaggaaa tcctgaagtt tcctcacatc agccagtgtg       960
     aagacctccg aaggaccata gacagagatt actacagtct atgtgacaag caaccaattg      1020
     ggagactgct ttttcgacag ttctgtgaaa ccaggcctgg gctggagtgc tacattcagt      1080
     tcctggactt agtggcagaa tatgaaatta ctccagatga aaaccttggg gcgaagggga      1140
     aggaaataat gaccaagtac ctcactccaa agtccccagt cttcattgcc caagttggac      1200
     aggacctggt ctcccagaca gagaagaagc tcctgcagag cccctgcaaa gaactcttct      1260
     ctgcttgtgc tcagtctgtc catgactact tgaagggaga ccccttccac gagtacctgg      1320
     atagcatgta ttttgaccgt tttctgcagt ggaaatggtt agaaagacaa ccagtgacca      1380
     aaaacacttt ccggcagtac cgagtgctgg gcaaaggggg ctttggagag gtctgtgcct      1440
     gccaggttcg ggccactggt aaaatgtatg cttgtaaacg cttagagaag aagaggatca      1500
     aaaagaggaa aggcgaatcc atggcactca acgaaaagca gattcttgag aaggtcaaca      1560
     gccagtttgt ggtcaacctg gcctatgcct atgaaaccaa agatgcacta tgcctggttc      1620
     tgaccattat gaatggtggt gacctgaagt ttcacatcta caatatgggg aatcctggct      1680
     ttgaggaaga gcgagcctta ttttatgcag ctgagatcct ctgtggccta gaagacttac      1740
     accgtgagaa cactgtctat agagatctaa aacccgaaaa catcttgctg gatgattatg      1800
     gccacataag gatctcagac ctcggactgg ccgtgaagat ccccgaggga gaccttatcc      1860
     gtggccgggt aggcactgtt ggctacatgg ccccagaagt tctgaacaac cagcgatatg      1920
     gactgagccc tgactactgg ggcctgggct gcctcatcta tgagatgatt gaaggccagt      1980
     caccatttcg aggtcgcaag gagaaggtta agcgggaaga ggtggatcgc cgggtgctgg      2040
     agactgagga agtgtattcc tccaagttct ctgaagaggc caagtccatc tgcaacatgc      2100
     tgctcaccaa agactcgaag cagaggctgg gctgccagga ggagggggcc gccgaggtca      2160
     agaggcaccc tttcttcagg aacatgaact ttaagcgcct ggaggctggg atgttggacc      2220
     ctcccttcgt tccagatccc cgggctgtat actgcaagga tgtgctggac attgagcagt      2280
     tctccactgt gaaaggtgtc aacctggacc atacggacga tgatttttac tcaaagttct      2340
     ctacaggctc tgtgccaatt ccatggcaaa atgagatgat agaaacagaa tgtttcaagg      2400
     agctgaatgt gttcggacct aacggtaccc tctcaccaga cctgaacaga agtcagcctc      2460
     cagaaccgcc aaagaaaggg ctgttccaca gactcttcag gcgtcagcat caaagcaatt      2520
     ccaagagttc acctactcct aagaccagtt gtaaccaccg aataaattca aaccacatca      2580
     attcaaactc cactggaagc agctagtttc ggctctggcc ttgaagtcaa aagtggaacc      2640
     agctcagagc cttctacttg gaagcagaac ttgtagccag gggagcttcc actgtggctc      2700
     agtggccagc aaagctccag tgggaactaa gataggagac cgttccccca ataacaaacc      2760
     tccaagtttc tcaaagaaat ttccactcag gtctgttttc caaggtggcc ccaagctggg      2820
     gtggactaga attttccttg ttgaacattg caatagaaac ccaatgggat atgacagctt      2880
     gcacggattt taatagcatc ctaactagaa ctgaattttg tctttattat ttttaaagga      2940
     aagttttgta aatttctcta ttgtctctgt ttacattttg tatatttgta tttaagtgaa      3000
     agtcagactt tgagggtgta tattttctgt gcagccactg ttaagccatg tgttttaaga      3060
     cattttagat tggagggggg gttacaaaaa tgtgactcta gacttccaga gcctcaaaag      3120
     agataatgtt tttattaaat atagaaaata tctcactttt c                          3161
//