Dbfetch

ID   AK135043; SV 1; linear; mRNA; HTC; MUS; 2918 BP.
XX
AC   AK135043;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus adult male olfactory brain cDNA, RIKEN full-length enriched
DE   library, clone:6430554L13 product:glutamate receptor, ionotropic, AMPA3
DE   (alpha 3), full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2918
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; a2f7a5f9d11c80fa98e59278aaa60102.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=6430554L13
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2918
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="6430554L13"
FT                   /tissue_type="olfactory brain"
FT                   /db_xref="taxon:10090"
FT   CDS             18..1193
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="glutamate receptor, ionotropic, AMPA3 (alpha 3)
FT                   (MGD|MGI:95810 GB|NM_016886, evidence: BLASTN, 99%,
FT                   match=2906)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3UY17"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:95810"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UY17"
FT                   /protein_id="BAE22396.1"
FT                   /translation="MGQSVLRAVFFLVLGLLGHSHGGFPNTISIGGLFMRNTVQEHSAF
FT                   RFAVQLYNTNQNTTEKPFHLNYHVDHLDSSNSFSVTNAFCSQFSRGVYAIFGFYDQMSM
FT                   NTLTSFCGALHTSFVTPSFPTDADVQFVIQMRPALKGAILSLLGYYKWEKFVYLYDTER
FT                   GFSILQAIMEAAVQNNWQVTARSVGNIKDIQEFRRIIEEMDRRQEKRYLIDCEVERINT
FT                   ILEQVVILGKHSRGYHYMLANLGFTDIVLERVMHGGANITGFQIVNNENPMVQQFIQRW
FT                   VRLDEREFPEAKNAPLKYTSALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAV
FT                   PWSQGIDIERALKMVQVQGMTGNIQFDTYGRRTNYTIDVYEMKVSGSRKAG"
XX
SQ   Sequence 2918 BP; 849 A; 622 C; 704 G; 743 T; 0 other;
     gagccaggca gaagaaaatg gggcaaagcg tgctccgggc ggtcttcttt ttagtcctgg        60
     ggcttttggg tcattctcac ggaggattcc ccaacaccat cagcataggt ggacttttca       120
     tgagaaacac ggtacaggag cacagtgctt tccgctttgc tgtgcagtta tacaacacca       180
     accagaacac cactgagaag cccttccatt tgaactacca cgtagaccac ttggattcct       240
     ccaatagttt ttctgtgact aatgctttct gctcccagtt ctccagaggg gtgtatgcta       300
     tctttggatt ctatgaccag atgtcaatga acacactgac ctccttctgt ggggccctgc       360
     atacatcttt cgtcacacct agctttccca ctgatgccga tgtgcagttt gtcatccaga       420
     tgcgcccagc cttaaagggt gccattctga gtcttctggg ttactacaag tgggagaagt       480
     ttgtgtacct ctatgacaca gaacgagggt tttccatcct gcaagcaatt atggaagcag       540
     cagtgcaaaa caactggcaa gtgacagcaa ggtctgtggg aaacataaag gacatccagg       600
     aattcagacg catcattgaa gaaatggaca gaaggcagga aaaacgatac ttgattgact       660
     gtgaagtcga aaggattaac acaattttgg aacaggttgt gatcctgggg aaacattcaa       720
     gaggttatca ctacatgctt gctaacctgg gttttactga cattgtactg gaaagagtca       780
     tgcatggggg agccaacatt acaggtttcc agattgtcaa caatgaaaac ccaatggtcc       840
     agcaattcat acagcgctgg gtgagactgg atgaaaggga attccctgaa gccaagaatg       900
     caccactaaa gtatacatct gcactgacac acgacgcaat actggtcata gcagaagcct       960
     tccgatacct gaggaggcag cgagtggatg tatcccgcag aggcagtgct ggagactgct      1020
     tagcaaatcc tgctgtgccc tggagtcaag gaattgatat tgagagagct ctgaaaatgg      1080
     tgcaagtaca aggaatgact ggaaacatcc aatttgacac ttatggacgt aggacaaatt      1140
     ataccattga tgtatatgaa atgaaagtct caggctctcg aaaagctggt tagctggaat      1200
     gagtatgaaa ggtttgtgcc cttctcagat caacaaatca gcaatgacag ctcatcctcc      1260
     gagaacagga ccatcgtagt gactaccatt ctggaatcac catatgtaat gtataaaaag      1320
     aatcatgagc aactggaagg aaatgagcgc tatgaaggct attgtgtcga tttagcctat      1380
     gaaatagcca aacacgtaag gatcaaatac aaattgtcca ttgtcggtga tgggaaatat      1440
     ggcgcaaggg atccagagac taaaatatgg aatggcatgg ttggggaact tgtctatgga      1500
     agagctgata tagctgttgc tccactcact ataacattgg tccgtgaaga agtcatagat      1560
     ttttcaaagc catttatgag cctggggatc tccatcatga taaagaagcc tcagaaatca      1620
     aagccaggcg tattttcatt cctggatcct ttagcttatg aaatctggat gtgcattgtc      1680
     ttcgcttaca ttggagtcag tgtagttctc ttcctagtca gcagatttag cccttatgag      1740
     tggcacttgg aagacaacaa tgaagaacct cgtgacccac aaagccctcc tgatcctccc      1800
     aatgaatttg gaatatttaa cagtctttgg ttttccttgg gtgcttttat gcagcaagga      1860
     tgtgatattt ctccaagatc actttctggg cgcattgttg gaggggtttg gtggttcttc      1920
     accctgatca taatctcttc ctacactgca aaccttgctg ctttcctgac tgtggagagg      1980
     atggtgtccc ccatagagag cgctgaagat ttagccaagc agactgaaat tgcatacggg      2040
     accctggact ctggttcaac aaaagaattt ttcagaagat ccaaaattgc tgtgtatgag      2100
     aaaatgtggt cttacatgaa atccgcagag ccatctgtgt ttaccaaaac aacagctgat      2160
     ggggtagccc gagttcggaa gtccaaggga aagttcgcct tcctgctgga gtcaaccatg      2220
     aatgagtaca ttgagcagag aaagccgtgt gatacgatga aagttggtgg aaatctggat      2280
     tccaaaggct atggtgtggc aacccctaaa ggctcagcat taggaacgcc tgtaaacctt      2340
     gcagtattga aactcagtga acaaggcatc ttagacaagc tgaaaaacaa atggtggtac      2400
     gataaggggg aatgtggagc caaggactcc gggagtaagg acaagaccag tgctctaagc      2460
     ctgagcaatg tggcaggcgt gttctatata cttgtcggag gtctggggct ggccatgatg      2520
     gtggctttga tagaattctg ttacaaatca cgggcagagt ccaaacgcat gaaactcaca      2580
     aagaacaccc aaaactttaa gcctgctcct gccaccaaca ctcagaatta cgctacatac      2640
     agagaaggct acaacgtgta tggaacagaa agtgttaaga tctagggatc ccttcccacc      2700
     ggaagcatgc aatgagagga aatcactgaa aacgtggctg cttcaaggat cctgagccag      2760
     atttcactct ccttggtgtc gggcatgaca cgaatattgc tgatggtgca atgacctttc      2820
     aataggaaaa actgattttt tttttccttc agtgccttat ggaacactct gagacttgcg      2880
     acaatgcaaa ccatcattga aatctttttg ctttgctt                              2918
//