spacer

EBI Dbfetch

ID   AK134787; SV 1; linear; mRNA; HTC; MUS; 1865 BP.
XX
AC   AK134787;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus adult male medulla oblongata cDNA, RIKEN full-length enriched
DE   library, clone:6330563D11 product:Adiponectin receptor protein 2, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1865
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; e2ff27714c7f369a502817d13a80ab5e.
DR   Ensembl-Gn; ENSMUSG00000030168; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032272; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169744; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=6330563D11
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1865
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="6330563D11"
FT                   /tissue_type="medulla oblongata"
FT                   /db_xref="taxon:10090"
FT   CDS             169..1329
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="Adiponectin receptor protein 2 (UniProt|Q8BQS5,
FT                   evidence: FASTY, 100%ID, 100%length, match=1158)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q53YY3"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="MGI:MGI:93830"
FT                   /db_xref="UniProtKB/TrEMBL:Q53YY3"
FT                   /protein_id="BAE22285.1"
FT                   /translation="MNEPAKHRLGCTRTPEPDIRLRKGHQLDDTRGSNNDNYQGDLEPS
FT                   LETPVCSSYYENSPEEPECHDDNSQEDEGFMGMSPLLQAHHAMERMEEFVCKVWEGRWR
FT                   VIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLG
FT                   IFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSG
FT                   IALLIMGSFVPWLYYSFYCNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGV
FT                   FVGLGLSGIIPTLHYVISEGFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGK
FT                   CDIWFHSHQLFHIFVVAGAFVHFHGVSNLQEFRFMIGGGCTEEDAL"
XX
SQ   Sequence 1865 BP; 449 A; 455 C; 454 G; 507 T; 0 other;
     aagtctttcc acacaacaca agaatccgtg gagctcagca gtaccctcag actctggtct        60
     acaactctga caggatttgg ggtcaactta ccatccctta aaaatccatt ctcccaagaa       120
     gaagggacag aaagaaagac cactttgtaa gaaaggcttt ggtatcccat gaacgagcca       180
     gccaaacacc gattggggtg caccaggact ccagagccag atatacggct cagaaaaggg       240
     caccaacttg atgatacaag gggaagtaat aatgacaact accaaggaga tttggagccc       300
     agcttagaga cacctgtttg ttcttcctat tatgaaaata gcccggagga gcccgagtgt       360
     catgatgaca attcccagga agatgaaggg tttatgggca tgtccccgct cctacaggcc       420
     catcatgcta tggaacgaat ggaagagttt gtttgtaagg tgtgggaagg ccgatggcga       480
     gtgatccctc acgatgtgct accggattgg cttaaggata atgacttcct tctccatgga       540
     caccggcctc ctatgccttc ctttcgggcc tgttttaaga gcatttttag aatacacaca       600
     gagacgggca acatttggac acatctccta ggttgtgtat tcttcctgtg cctggggatc       660
     ttttatatgt ttcgcccaaa tatatctttt gtggcccctc tgcaagagaa agtggtcttt       720
     ggcttgttct tcttgggagc cattctctgc ctttcctttt catggctctt ccacacggtg       780
     tactgccact cagaaggggt ctcccgactc ttctctaaat tggattactc tggtattgct       840
     cttctgatca tgggaagttt tgttccttgg ctttattatt ctttctactg taacccacaa       900
     ccttgcttca tctacctgat tgtcatctgt gtgctgggca ttgcagccat tatcgtctct       960
     cagtgggaca tgtttgccac ccctcagtat cggggggtca gagcaggagt gttcgtgggc      1020
     ttaggcctga gtggaatcat ccctaccttg cattatgtca tctcagaagg gttcctgaag      1080
     gctgccacca tagggcagat aggctggcta atgcttatgg ctagcctcta tatcaccgga      1140
     gctgccctct atgcggcccg tatccctgag cgcttctttc ctggcaaatg tgacatctgg      1200
     tttcactctc atcagctctt ccacatcttt gtggttgctg gtgcctttgt tcacttccac      1260
     ggagtctcaa acctgcagga atttcgtttc atgattggcg ggggctgcac tgaagaggat      1320
     gcactgtgat actctccagg aaccagggac tctgaccctg agccaggcct gcaggtcctg      1380
     caggccttct tactggctgt cggtgccagt gccagagaag ccccaaaact tggacagcct      1440
     catgggcctt gtgttggccc aagggctcca tggggtacaa gactaagaag agaaaaacaa      1500
     aaataaatca tacctcaaag gatggaatgc atcgattagg agagaaggag aaatggctca      1560
     tcccctggct tcctcttggg atctaccgat tgaaagcaac tctgcaagac cctcgcctga      1620
     caggctggct tctgatgtga tcgtatttat ttgtagaaga tggggaaaca gtttagttgg      1680
     tggtctttct tctcccttcc ttgctccttg cagcagtaac atgtatgagt accatgcacc      1740
     aactgatcgt gccattggag ctccttaaac agtaatcaca accaagttag gggaacattt      1800
     gtatccaata aaggggtggg agtgcggttt taggcactcc tttgggagaa caaagaaatt      1860
     aatgc                                                                  1865
//


spacer
spacer