Dbfetch

ID   AK134616; SV 1; linear; mRNA; HTC; MUS; 3169 BP.
XX
AC   AK134616;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus adult male medulla oblongata cDNA, RIKEN full-length enriched
DE   library, clone:6330501L09 product:klotho, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3169
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; b45bbeba0d64dd12a4f3e57d35cdb560.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=6330501L09
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3169
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="6330501L09"
FT                   /tissue_type="medulla oblongata"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..1207
FT                   /codon_start=2
FT                   /transl_table=1
FT                   /note="klotho (MGD|MGI:1101771 GB|NM_013823, evidence:
FT                   BLASTN, 99%, match=3167)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q3UYK1"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR028546"
FT                   /db_xref="MGI:MGI:1101771"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UYK1"
FT                   /protein_id="BAE22211.1"
FT                   /translation="NHTVLHFYRCMISELVHANITPVVALWQPAAPHQGLPHALAKHGA
FT                   WENPHTALAFADYANLCFKELGHWVNLWITMNEPNTRNMTYRAGHHLLRAHALAWHLYD
FT                   DKFRAAQKGKISIALQADWIEPACPFSQNDKEVAERVLEFDIGWLAEPIFGSGDYPRVM
FT                   RDWLNQKNNFLLPYFTEDEKKLVRGSFDFLAVSHYTTILVDWEKEDPMKYNDYLEVQEM
FT                   TDITWLNSPSQVAVVPWGLRKVLNWLRFKYGDLPMYVTANGIDDDPHAEQDSLRIYYIK
FT                   NYVNEALKAYVLDDINLCGYFAYSLSDRSAPKSGFYRYAANQFEPKPSMKHYRKIIDSN
FT                   GFLGSGTLGRFCPEEYTVCTECGFFQTRKSLLVFISFLVFTFIISLALIFHYSKKGQRS
FT                   YK"
FT   regulatory      3149..3154
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      3169
FT                   /note="putative"
XX
SQ   Sequence 3169 BP; 829 A; 708 C; 684 G; 948 T; 0 other;
     aaaccacacg gttctgcact tctaccgctg catgatcagc gagctggtgc acgccaacat        60
     cactccagtg gtggccctgt ggcagccagc agccccgcac caaggcctgc cacatgccct       120
     tgcaaaacat ggggcctggg agaacccgca cactgctctg gcgtttgcag actacgcaaa       180
     cctgtgtttt aaagagttgg gtcactgggt caatctctgg atcaccatga acgagccaaa       240
     cacacggaac atgacctatc gtgccgggca ccacctcctg agagcccatg ccttggcttg       300
     gcatctgtac gatgacaagt ttagggcggc tcagaaaggc aaaatatcca tcgccttgca       360
     ggctgactgg atagaaccgg cctgcccttt ctctcaaaat gacaaagaag tggccgagag       420
     agttttggaa tttgatatag gctggctggc agagcctatt tttggttccg gagattatcc       480
     acgtgtgatg agggactggc tgaaccaaaa aaacaatttt cttttgccct atttcaccga       540
     agatgaaaaa aagctagtcc ggggttcctt tgacttcctg gcggtgagtc attacaccac       600
     cattctggta gactgggaaa aggaggatcc gatgaaatac aacgattact tggaggtaca       660
     ggagatgact gacatcacat ggctcaactc tcccagtcag gtggcagtgg tgccttgggg       720
     gctacgcaaa gtgctcaact ggctaaggtt caagtacgga gacctcccga tgtatgtgac       780
     agccaatgga atcgatgatg acccccacgc cgagcaagac tcactgagga tctattatat       840
     taagaattat gtgaatgagg ctctgaaagc ctacgtgttg gacgacatca acctttgtgg       900
     ctactttgcg tattcactta gtgatcgctc agctcccaag tctggctttt atcgatatgc       960
     tgcgaatcag tttgagccca aaccatctat gaaacattac aggaaaatta ttgacagcaa      1020
     tggcttcctg ggttctggaa cactgggaag gttttgtcca gaagaataca ctgtgtgcac      1080
     cgaatgtgga ttttttcaaa cccggaagtc tttgctggtc ttcatctcgt ttcttgtttt      1140
     tacttttatt atttctcttg ctctcatttt tcactactcc aagaaaggcc agagaagtta      1200
     taagtaatgt gaacgtctgc ctggccattc gctttgggat caagatgtac acgccgtcag      1260
     ccgtttgcac ctctctgtgt tgtgagccgc attccacaca tttcgattct agaaaaccct      1320
     ttttgtcatg ggtggtagag gttttaaaca ggaattggtg agaataaaat attgcagggt      1380
     gaatggtatc tgaatctgct ctctttggtg gcaattacgg aattatactc accacagttt      1440
     ctacagtgcc ccggaatgga aggcatagaa tacggtaggg ataacagtgc caagcagaca      1500
     gaagtttaaa gaacaacttt agggacttgt ttatccatgg ccatttttaa attcactcct      1560
     gttggggagt aacactctct caattaccat cttaacacct ggactttacc tgatccagtt      1620
     ttacaaggtg aagtagaaaa atatccagta aaggtgggca agagccctga gtccagagca      1680
     gcccattaag aagcactatt cctaccaaat gctgctaatg tcaatttaca aatatactta      1740
     gaaagcacat tatggacatt tgtattcttg tgaatgtttt tgaggtgtgc cctaaacccc      1800
     agatccttga gggctttctc ttaccaactt tcctttcaga gcctgcttgt tggagattct      1860
     tccccagccc ccttcccctt tccctcttgc tctgccccac ctcgctccac ccagcttgct      1920
     ccagcccaaa gattctttat ttgtttctca ttaccgaagg ttgtgagcca ccatgtggtt      1980
     tctgggattt gaactcatga cctccggagg agctgtcatg ctcttaacca gcccatgttg      2040
     aagattcttt tgataaatat tcacaaaaaa taaagatgag ccatgagctg ttggcctctt      2100
     cggaagcgga aactgagtga tttgattgaa catcctttta tctttgacca gaccttggaa      2160
     tgaatgcaat gacctttccc acaggaagaa ggaggagctc tcagtcaaac tgtaaagaat      2220
     gcctcttcag aatatgctgt cagtgcttgg atgccatgat gttcaacttt cttagtcgat      2280
     ccggcagcaa tcacagtgtg agcacactgg gaacctgtcc ttgcggccgc cgagatctac      2340
     cgtgtgcttc tgtgaagagg ctttgacgta gcccctcttt gagctcttac accatgctac      2400
     tgacttctag aaaggctaat taggtcttct tctacaccta ataccctaag tcttactgac      2460
     tctcacggga gaagtctctg tgctacacct gagtggtctt attgataacc ctgataccag      2520
     atcaggcaag ataaatccgt catagcaggc atggctaccc ttgctgccac agggtcacag      2580
     cacatagctc atcaccctgt tattcttcat cttgcaatgt ggtatggttt tcctggtgaa      2640
     tgatcagctt ttgctgtggt attctttata catctggact tattattgaa atcaaatgct      2700
     atagaatcaa tagtttattt tatgtctatt tttcttgatc gcagagtaat atatattaat      2760
     tgtaaaaaat ttaagaaaca aaaactatat gtaaagaaaa aattataata taatacagag      2820
     atgctgctga cagttcctat gtgttgtgtt ttgtatactg agatcatgtg atacgtaggc      2880
     atacatcttc ttgggttttt ttgtttttgt tttttgtttt gttttgtttt gttttggttt      2940
     tttgagatag ggtttctctg tatagccctg gctgtcctgg aactcacttt gcagaccagg      3000
     ctagcctcaa actcttattc atttttactg aagtaatttt tctgtcatta gtcttcaaga      3060
     gcaaaacttt aatagttatg gagaatattg ccagaacagc tcaaaactgt tttatttgtt      3120
     ggtccaattt cccattaatt agttcaataa taaatatcat ttagaaatg                  3169
//