spacer

EBI Dbfetch

ID   AK134000; SV 1; linear; mRNA; HTC; MUS; 2169 BP.
XX
AC   AK134000;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus adult male thymus cDNA, RIKEN full-length enriched library,
DE   clone:5830403O09 product:Pbx/knotted 1 homeobox, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2169
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 845c9a8f2f9cfa84a08c56fbe8e92b50.
DR   Ensembl-Gn; ENSMUSG00000006705; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097352; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000175806; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000176701; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=5830403O09
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2169
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="5830403O09"
FT                   /tissue_type="thymus"
FT                   /db_xref="taxon:10090"
FT   CDS             331..1641
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="Pbx/knotted 1 homeobox (MGD|MGI:1201409 GB|AF061270,
FT                   evidence: BLASTN, 99%, match=1899)"
FT                   /note="putative"
FT                   /db_xref="GOA:O70477"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR008422"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="MGI:MGI:1201409"
FT                   /protein_id="BAE21975.1"
FT                   /translation="MMATQTLSIDSYQDGQQMQVVTELKTEQDPNCSDPDAEGVSPPPI
FT                   ESQTPMDADKQAIYRHPLFPLLALLFEKCEQSTQGSEGTTSASFDVDIENFVRKQEKDG
FT                   KPFFCEDPETDNLMVKAIQVLRIHLLELEKVNELCKDFCSRYIACLKTKMNSETLLSGE
FT                   PGSPYSPVQSQQIQSAITGTLSPQGIVVPASALQQGNVTMATVAGGTVYQPVTVVTPQG
FT                   QVVTQALSPGTIRIQNSQLQLQLNQDLSILHQEDGSSKNKRGVLPKHATNVMRSWLFQH
FT                   IGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRILQPMLDSSCSETPKTKKKPAQNR
FT                   PVQRFWPDSLASGVAQATPSELAMSEGAVVTITTPVNMNVDSLQSLSSDGATLAVQQVM
FT                   MAGQSEDESVDSTEDEGGALAPTHISGLVLENSDSLQ"
XX
SQ   Sequence 2169 BP; 536 A; 545 C; 575 G; 513 T; 0 other;
     tgagtgtgat gaagattggc acccaggtgc tgggtgttag agtgggacgt gtcttgtgga        60
     ggactcagct catctccatg tgtaccctct gtgccctgat ggtgaccaag tgattccagt       120
     cccggctcct ctgctcagtt tccggaaagg tatcttgaga ctcgtctgca gcctgagatg       180
     tcctgccttg tttcccttcc aagccatgga gctgttctta gatgtttgct cgtctcggga       240
     cccgtgcacg gctctgttct tccaggtgct cagacaccgt gtgcttctcg ctcaagatga       300
     tctgatgtct gaagtggact ctcactaacc atgatggcga cacagacgct aagtatagac       360
     agctatcaag atggacagca aatgcaggtg gtcacggagt taaaaacaga gcaagatccc       420
     aactgctctg acccagatgc agaaggagtg agtcctcctc ccatcgagtc tcagacccca       480
     atggatgccg acaagcaggc catttatagg catccactat ttccgttgct agctttgttg       540
     tttgagaagt gtgagcagtc cacacagggc tcagaaggca cgacgtctgc cagcttcgat       600
     gtggacattg agaactttgt caggaagcaa gaaaaggatg ggaaaccctt cttctgtgaa       660
     gatccggaaa ctgacaacct aatggtgaaa gcaatccagg tcctgcgcat tcatcttctt       720
     gaactggaga aggttaatga gctctgtaaa gatttctgta gtcggtacat tgcttgtctg       780
     aagacaaaaa tgaacagcga gaccttgttg agtggggagc ctggaagtcc gtactcccct       840
     gtgcaatccc agcagattca gagtgccatc acaggcacgc tcagccccca gggaatcgtg       900
     gtgccagcat cagccctaca acagggaaat gtaaccatgg caacagtggc aggtggcaca       960
     gtgtaccagc ctgtcaccgt cgtcactccg caaggccaag tggtcacgca ggcattatct      1020
     cctgggacaa ttaggatcca gaactcacag ctgcagttgc agttgaacca agacctcagc      1080
     atcttgcatc aagaggatgg ctcctccaag aacaagaggg gtgtcctgcc gaagcacgcc      1140
     accaacgtga tgcggtcctg gctctttcag cacatagggc atccctaccc aacagaggat      1200
     gagaaaaagc agattgctgc tcagacgaat ctgaccctgc ttcaagtcaa caactggttc      1260
     atcaacgcga gaagacgaat tctccagcca atgttggatt ccagctgctc agagactcca      1320
     aaaacgaaga aaaaacctgc tcagaacagg ccagttcaga ggttttggcc agattctctt      1380
     gcatcaggag tggcacaagc aacacccagc gagcttgcca tgtcagaagg tgccgttgtg      1440
     accatcacca cacctgtaaa catgaatgtg gacagccttc agtccctgtc ctcagacggg      1500
     gccaccctgg ccgtacagca ggtcatgatg gcagggcaga gtgaggacga gtcggtggat      1560
     agcacagagg atgagggcgg cgccctggcg cccacacaca tcagcgggct ggtgctggag      1620
     aacagcgact cccttcagta ggaagcacca acggggtcag tgtggagctg ggcgctggac      1680
     tcttcactgt ttgcacagca agcatcttac agttgtcttt gtaacctgtt ttatatgtag      1740
     atatagaagg tgcacttttg tatttcgcag caagcttcaa gacgtctttg ccggtgcagc      1800
     gacttccttc agatgtgcgt gtatgggttt ttaatgctag aaacgtggcc cctgcccctt      1860
     gagtccttga cgagattaag gaaaagtgct gccattttct aaaattctgc agttgcaatt      1920
     gagtcgtgtg gtttacagca ggtctggggg cggctgctgg tgccgctcac aggtctgaaa      1980
     gatgacctgc acgcaggctg cagagcgaga gggctctggc cccggtgggc tgtgggtgcc      2040
     caccacacac ttcagttctc tcaggcagca tttgcctgtt tcatttgcta tatagaaaaa      2100
     gaaactccta tttttacctt gctgggatta ttggataaaa agctattttt ataaatcagt      2160
     tattaattg                                                              2169
//


spacer
spacer