Dbfetch

ID   AK133983; SV 1; linear; mRNA; HTC; MUS; 3512 BP.
XX
AC   AK133983;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 12)
XX
DE   Mus musculus 8 days embryo whole body cDNA, RIKEN full-length enriched
DE   library, clone:5730591M17 product:calcitonin receptor, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3512
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 9164897a4c89c84f8d9ec4b23709cd32.
DR   Ensembl-Gn; ENSMUSG00000023964; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030422; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0030395; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0030322; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030404; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030118; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030859; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029519; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0030096; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0030240; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0030194; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0030327; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030230; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030889; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029234; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029596; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000075644; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115622; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168592; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170266; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171613; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076140; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0076217; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0076122; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076157; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0075780; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0076631; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076328; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0075743; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0075892; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0075784; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0075941; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0075806; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0076866; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0075781; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0074911; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=5730591M17
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3512
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="8 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="5730591M17"
FT                   /tissue_type="whole body"
FT                   /db_xref="taxon:10090"
FT   CDS             307..1797
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="calcitonin receptor (MGD|MGI:101950 GB|AK039161,
FT                   evidence: BLASTN, 99%, match=2453)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q60755"
FT                   /db_xref="InterPro:IPR000832"
FT                   /db_xref="InterPro:IPR001688"
FT                   /db_xref="InterPro:IPR001879"
FT                   /db_xref="InterPro:IPR003287"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR017983"
FT                   /db_xref="MGI:MGI:101950"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60755"
FT                   /protein_id="BAE21967.1"
FT                   /translation="MTPRRSRVKRRNLRKPKMRFLLVNRFTLLLLLLVSPTPVLQAPTN
FT                   LTDSGLDQEPFLYLVGRKKLLDAQYKCYDRIHQLPSYEGEGLYCNRTWDGWMCWDDTPA
FT                   GATAYQHCPDYFPDFDTAEKVSKYCDENGEWFRHPDSNRTWSNYTLCNAFTSEKLQNAY
FT                   VLYYLALVGHSLSIAALVASMLIFWIFKNLSCQRVTLHKHMFLTYILNSIIIIIHLVEV
FT                   VPNGDLVRRDPISCKVLHFLHQYMMSCNYFWMLCEGIYLHTLIVMAVFTDEQRLRWYYL
FT                   LGWGFPIVPTIIHAITRALYYNDNCWLSAETHLLYIIHGPVMVALVVNFFFLLNIVRVL
FT                   VTKMRQTHEAESYMYLKAVKATMVLVPLLGIQFVVFPWRPSNKVLGKIYDYLMHSLIHF
FT                   QGFFVATIYCFCNHEVQVTLKRQWTQFKIQWSQRWGRRRRPTNRVVSAPRAVAFAEPDG
FT                   LPIYICHQEPRNPPISNNEGEESTEMIPMNVIQQDASA"
XX
SQ   Sequence 3512 BP; 936 A; 834 C; 750 G; 992 T; 0 other;
     gatctcggag cgagcagcgg caggcactgc taaggagagc cagccgccca agactctggg        60
     cggactgcac ctggctggct tgcagacaac tcttggttgg agaggtgctt acttctgcgc       120
     ctcaccctgc cgttggcatc ccctgcctgc agatgcccag tgaagtctgc gttcctgaga       180
     acacctgagc tgtgcccaga catccagcaa gagaattcct gcatccacct aaggtaagtg       240
     ccattagagc gccttccaga ggagaagaaa ccgagggagc agggctacta cacagaggat       300
     ttgaaaatga ctccaaggag gtccagagtg aaaaggcgga atctccgcaa accgaagatg       360
     aggttccttc tcgtgaacag gttcaccctg ctgctcctgc tcctagtgag cccaactcca       420
     gttcttcagg ctcctaccaa tctcactgac tccggccttg atcaggagcc attcctgtac       480
     ttggttggcc gcaagaagct gctggatgct cagtacaaat gctatgaccg gattcatcag       540
     ttgccctctt atgaaggaga aggtctgtac tgcaaccgca cctgggatgg ctggatgtgc       600
     tgggacgaca ctcccgctgg agccacagcc tatcagcact gccctgacta cttcccggac       660
     tttgacacag cagaaaaggt ttcaaaatac tgtgatgaaa atggagagtg gtttagacac       720
     cctgacagca accgaacctg gtccaactat actctgtgca acgctttcac ttctgagaaa       780
     ctgcaaaatg cgtacgttct ttattacctg gctcttgtgg gtcactcctt gtcgattgct       840
     gctttggttg cttccatgct gatcttctgg attttcaaga accttagctg ccagagggtg       900
     accttgcaca agcacatgtt ccttacttat attctgaatt ctatcattat catcatccac       960
     ctggttgagg ttgtgcccaa tggagatctg gtgcggcggg atcctataag ttgcaaggtt      1020
     ctacactttt tacatcagta catgatgtct tgcaactact tctggatgct ctgcgagggg      1080
     atctatcttc atactctgat tgtcatggct gtgtttaccg acgagcaacg cctacgctgg      1140
     tactatcttc ttggctgggg gttcccgata gtgccaacca ttatccacgc catcactcgt      1200
     gccctctact acaacgacaa ctgctggctg agtgcagaaa cccacttgct ttacatcatc      1260
     catggacccg tcatggtggc tctggtggtc aacttcttct ttcttctcaa cattgtccgc      1320
     gtgcttgtga ccaagatgag gcaaacccac gaggccgagt cctacatgta cctgaaggct      1380
     gtgaaggcca ccatggtcct tgtgcccctg ctggggatcc agtttgttgt gtttccctgg      1440
     aggccctcca acaaggtgct tgggaagatc tatgattatc tcatgcactc tctgattcat      1500
     ttccagggat tctttgtggc gactatctac tgcttctgca accatgaggt gcaagtcacc      1560
     ctgaagcgcc agtggacgca gttcaagatc cagtggagcc aacgctgggg aaggcgccgc      1620
     cgccccacca accgcgtagt tagtgctcct cgggctgtag ccttcgctga gccagatggc      1680
     ctccccattt acatctgcca tcaggaacca cggaatcctc caatcagcaa caacgaaggc      1740
     gaggagagta ctgaaatgat ccccatgaac gtcatccagc aagacgcatc cgcttgaatg      1800
     tgaagccacc ccaagcattg tgatccactg agccttcatt tcctggggaa agacagacca      1860
     tgtgtttcaa gtgattccca tcctcccagg agctgaccat atcatttgtg aagaagtgtt      1920
     aagtgaattt gtccatagtg aatttgaaga aagtgattct tggtactatt gctttgggag      1980
     tcagtctagg aatagagtct cccattgcaa cttgtgaact ccatcattca tcctggactg      2040
     agatgactgt gttcgtagga aagcaggcaa ggtgttcaaa agatgtcaca ctattgacct      2100
     agttcagata cagggtgctc cttgtgaatt ttgagccatt tgtaccgttg agaaattaaa      2160
     atcactctca atgtttttaa atttgacact ggattttgaa ttagactatt tctgtatttg      2220
     actacagatc tggtttttaa tgtttttatt tcagtcagtt cctatattac acatgttacc      2280
     atccatacaa tgtcaactac acatatagca tgacctctga aagatggtgt gtcttttata      2340
     acatgatcca gttcaccagg cagacccaaa tgctgtaatg aattgatctg aaccttgtat      2400
     gtgctttggt cactgacatt tataagttgg gaggtcacca agaacctatc accaaattta      2460
     tcacaaaact gccctccaaa atgtaacaat ctttaaagag agttttccac tttcctaaac      2520
     tacaggattt ataaaacaaa tcactccaag gtttataaag cagattacct cttgcccttg      2580
     ggtgctatct agcagtaaga gaaagatttg tttacgactg gtaattaaaa gactccatac      2640
     aagtccatta actgccttcc acccagcttc aaagctaaac aagatccctg tgtttttcaa      2700
     gaagactctg tgtggctaat tacaaatcag tttcttgttg acctcttgct tgcagctatt      2760
     agcaaaacaa gagggggaaa aaacccacaa tgtagggact tcaaatttaa cctcatatta      2820
     attcatctta aattaaaaac agagcttctc atcaaaaccc agtactatat ctccataccc      2880
     ctctttactc cccagtagga gatcatctaa gatccatgaa taaaccaata ccatcacaga      2940
     tttctgaatc tgcaacagta accagtcatc attacttaat ttgtatgcta aatgaggagc      3000
     ttttttgaga ccctcaaaat ctcctctcac ctttgtaatc ttttgtcact gcctttcaga      3060
     ggtgatttag ttgtgtaaag acaaaagtaa cttgatttgt tctggttaca tgcttggtgt      3120
     acccagagaa aactgtattt caatagcaac tgtggacctt ggatactgag agttgccttt      3180
     accaaaatgg aaggacggat tgaaggaagg atgttttttc aatcacagtg ttacctggag      3240
     atgtccctat gttttgttta cacacatcga aatcagtgta tttcaggcag ctctagtaca      3300
     aatgtgataa tatattgaag tgtttgagat gttattgtgc ttatgtagta ggagctgatg      3360
     aaatcaaact gacttaccat aacattgcat gtcataccta aattgtgtga aacgcttctg      3420
     ctgtgtacat gtataaatac agagcatatt aaaaaggcaa agatgtatat tggcatattt      3480
     ttataaagaa atacatttgt catctttcat tc                                    3512
//