spacer

EBI Dbfetch

ID   AK133207; SV 1; linear; mRNA; HTC; MUS; 4142 BP.
XX
AC   AK133207;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus adult male testis cDNA, RIKEN full-length enriched library,
DE   clone:4932416M19 product:TAR DNA binding protein, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4142
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 2f0006400e97984fb442a658fb1db74a.
DR   Ensembl-Gn; ENSMUSG00000041459; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000084125; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=4932416M19
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4142
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="4932416M19"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10090"
FT   CDS             108..1352
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="TAR DNA binding protein (MGD|MGI:2387629
FT                   GB|BC025544, evidence: BLASTN, 99%, match=2873)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q921F2"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="MGI:MGI:2387629"
FT                   /db_xref="PDB:3D2W"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q921F2"
FT                   /protein_id="BAE21557.1"
FT                   /translation="MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRN
FT                   PVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTS
FT                   DLIVLGLPWKTTEQDLKDYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMS
FT                   QRHMIDGRWCDCKLPNSKQSPDEPLRSRKVFVGRCTEDMTAEELQQFFCQYGEVVDVFI
FT                   PKPFRAFAFVTFADDKVAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNPG
FT                   GFGNQGGFGNSRGGGACLGNNQGGNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGML
FT                   ASQQNQSGPSGNNQSQGSMQREPNQAFGSGNNSYSGSNSGAPLGWGSASNAGSGSGFNG
FT                   GFGSSMDSKSSGWGM"
FT   regulatory      4121..4126
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      4142
FT                   /note="putative"
XX
SQ   Sequence 4142 BP; 1109 A; 732 C; 985 G; 1316 T; 0 other;
     gcattttgtg ggcacggagc ggtagcgcgg ctgttgtcgg attccttccc gtctgtgctt        60
     cctccttgtg cttcctagca gtggcctagg cggagattta agcaaagatg tctgaatata       120
     ttcgggtaac agaagatgag aacgatgaac ccattgaaat accatcagaa gacgatggga       180
     cggtgttgct gtccacagtt acagcccagt ttccaggggc atgcggcctg cgctaccgga       240
     atcccgtgtc tcagtgtatg agaggagtcc gactggtgga aggaattctg catgccccag       300
     atgctggctg gggcaatctg gtatatgttg tcaactatcc caaagataac aaaaggaaaa       360
     tggatgagac agatgcttcc tctgcagtga aagtgaaaag agcagtccag aaaacatctg       420
     acctcatagt gttgggtctc ccctggaaaa caactgagca ggatctgaaa gactatttca       480
     gtacttttgg agaggttctt atggttcagg tcaagaaaga tcttaaaact ggtcactcga       540
     aagggtttgg ctttgttcga tttacagaat atgaaaccca agtgaaagta atgtcacaac       600
     gacatatgat agatgggcga tggtgtgact gtaaacttcc caactctaag caaagcccag       660
     acgagccttt gagaagcaga aaggtgtttg ttggacgttg tacagaggac atgactgctg       720
     aagagcttca gcagtttttc tgtcagtatg gagaagtggt agatgtcttc attcccaaac       780
     cattcagagc ttttgccttc gtcacctttg cagatgataa ggttgcccag tctctttgtg       840
     gagaggattt gatcattaaa ggaatcagcg tgcatatatc caatgctgaa cctaagcata       900
     atagcaatag acagttagaa agaagtggaa gatttggtgg taatccaggt ggctttggga       960
     atcagggtgg gtttggtaac agtagagggg gtggagcttg cttgggaaat aaccagggtg      1020
     gtaatatggg tggagggatg aactttggtg cttttagcat taacccagcg atgatggctg      1080
     cggctcaggc agcgttgcag agcagttggg gtatgatggg catgttagcc agccagcaga      1140
     accagtcggg cccatctggg aataaccaaa gccagggcag catgcagagg gaaccaaatc      1200
     aggcttttgg ttctggaaat aattcctaca gtggttctaa ttctggtgcc ccccttggtt      1260
     gggggtcagc atcaaatgca ggatcgggca gtggttttaa tgggggcttt ggctcgagca      1320
     tggattctaa gtcttctggc tggggaatgt aggtggtggg gggtggttag taggttggtt      1380
     attaggttag gtagatttag aatggtggga ttcaaatttt tctaaactca tggtaagtat      1440
     attgtaaaat acatatgtac taaaattttc agattggttt gttcagtgtg gagtatattc      1500
     agcagtattt ttgacatttt tctttagaaa aaaagagggg aaagctaaat gaattttata      1560
     agttttgtta tataaagggt taaaatactg agtgggtgaa agtgaactgc tgtttgccta      1620
     attggtaaac caacactaca attgatctca gaaggtttct ctgtaatatt ctatcattga      1680
     aattgttaat gaattctttg catgttcaga gtagaaacca ttggttagaa ctacattctt      1740
     ttctccttat tttaatttga atcccaccct atgaattttt tccttaggaa aatctccatt      1800
     tgggagatca tgatgtcatg gtgtttgatt cttttggttt tgtttttaac acttgtcttc      1860
     cttcatatac gaaagtacaa tatgaagcct tcatttaatc tctgcagttc atctcatttc      1920
     aaatgtttat ggaagaagca cttcattgaa agtagtgctg taaatattct gccataggaa      1980
     tacttctgtc tacatgcttt ctcatccaag aattcgtcat cacgctgcac aggctgcgct      2040
     ctttgacggt gggtgttcca tttttatccg ctactcttta tttcatggag tcgtatcaac      2100
     gctatgaacg caaggctgtg atatggaacc agaaggctgt ttgaactttt gaaaccttgt      2160
     gtgggattga tggtggtgcc gaggcatgaa aggctagtat gagcgagaaa aggagagcgc      2220
     gtgcagagac ttggtggtgg aaaatggata ttttttaact tggagagatg tgtcactcaa      2280
     tcctgtggct ttggtgagag agtgtgcaga gagcaatgat agcaaatagc gtacgaatgt      2340
     tttacatcaa aggacatcca catcagttgg aagactttga gttttgttct taggaaaccc      2400
     actttagttg aatgtgttaa gtgaaatact tgtacttccc tccccctctg tcaactgctg      2460
     tgaatgctgt atggtgtgtg ttctcctctg ttactgatct ggaagtgtgg gaacgtgaac      2520
     tgaagctgat gggctgcgaa catggactga gcttgtggtg tgctttgcag gagaacttgg      2580
     aagcagagtt caccagtgag ctcaggtgtc tcaaagaagg gtggaagttc tcatgtctgt      2640
     tagctattca taagaatgct gtttgctgca gttctgtgtc ctgtgcttgg atgctttttt      2700
     ataagagttg tcattgttgg aaattcttaa ataaaactga tttaaataat atgtgtcttt      2760
     gttttgcagc cctgaatgca aagaattcat agcagttaat tccccttttt gacccttttg      2820
     agatggaact ttcataaagt ttcttggcag tagtttattt tgcttcaaat aaacttattt      2880
     gaaaagttgt ctcaagtcaa atggattcat cacctgtcat gcattgacac ctgataccca      2940
     gacttaattg ctatttgttc ttgcattgtc caaagtgaaa gtttttcttt ggtttgtttt      3000
     taatttagtt tttcttaagt ctgggtgacc gcacctaaaa tggtaagcag ttaccctctg      3060
     gcttgttctg agtgcctctg tgcatttgat tttctattta catgctgtat aaatctccac      3120
     tggggaatca tgccttctaa aaatatttgg gagagggcaa aagagttgac ttctaatgct      3180
     ctgtagcaga gcatatcgat gcgtcataag gttaaccacc tttctgctgg gactgtggaa      3240
     agtgaattaa ttgccatacg gatcaagtag aagaaaccca gaaaccatgt gcctgaaata      3300
     cattaagaag ccttattgat agctttaaca gctactaggc tcgttctcgt accctgcgcc      3360
     atcctaactg aggtaggctt ttgccctcct caatgtgggg cttatgtact gatgaatatg      3420
     ctcaccagat cacattagcc tatcaatgca ctcctaatat aaaagccata atacattgat      3480
     tactatactt ttcctgtaac tactgagacc ggacgcgctc cttttctaac tggaagaatg      3540
     ggacagtttt tgtgttggta gtttttccta atgcccttac ctaaatagat tatgataaat      3600
     aggtttgtca ttttgcaagt tgcgtgtttt aaaattttat atccgttaga gacttgttat      3660
     gaacacattg tttcattata cagtatcctc tgtaaaagga tcgtgagtta ttgtaagttt      3720
     ttttctctgc atctaaccct gcatgatttc caaaccctgt gcatctgaat tttgcatttt      3780
     agcactgttt gcactgttac tcagcagcag taacatggta acattaaaat ggttttcggg      3840
     gacctccaaa gacggccagg agtcctgggg taagttactt gtcaatggca tggttttgat      3900
     ccctttttta cacttgttaa agacttactg gtcatagaag tctttcagtg ttgatcagcc      3960
     ttttaacatg tttatggatg acatagctgt agttagttac ttgccgtaaa tgaggtttta      4020
     gaaataaact acttggcaaa gatttggttt tgaaagtctg gtcatcaaaa cgcgttcatt      4080
     ccttagaaat aatgaagaac aactctttga accacagttg aataaaaggt tttcttgcca      4140
     cc                                                                     4142
//


spacer
spacer