Dbfetch

ID   AK133082; SV 1; linear; mRNA; HTC; MUS; 2299 BP.
XX
AC   AK133082;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus adult male testis cDNA, RIKEN full-length enriched library,
DE   clone:4930569A11 product:interleukin 4 induced 1, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2299
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 4724331c7e1f0f6a5d9a25e2a6863b67.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=4930569A11
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2299
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="4930569A11"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10090"
FT   CDS             261..2177
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="interleukin 4 induced 1 (MGD|MGI:109552
FT                   GB|NM_010215, evidence: BLASTN, 99%, match=1996)"
FT                   /note="putative"
FT                   /db_xref="GOA:O09046"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="MGI:MGI:109552"
FT                   /db_xref="PDB:2I8W"
FT                   /db_xref="UniProtKB/Swiss-Prot:O09046"
FT                   /protein_id="BAE21502.1"
FT                   /translation="MGARRAPQRPPCTLRLVLAATLLGLAGSLDWKAASSLNPIEKCME
FT                   DHDYEQLLKVVTLGLNRTSKPQKVVVVGAGVAGLVAAKMLSDAGHKVTILEADNRIGGR
FT                   IFTFRDEKTGWIGELGAMRMPSSHRILHKLCRTLGLNLTQFTQYDENTWTEVHNVKLRN
FT                   YVVEKMPEKLGYNLNNRERGHSPEDIYQMALNKAFKDLKALGCKKAMNKFNKHTLLEYL
FT                   LEEGNLSRPAVQLLGDVMSEEGFFYLSFAEALRAHACLSDRLRYSRIVGGWDLLPRALL
FT                   SSLSGALLLNAPVVSITQGRNDVRVHIATSLHSEKTLTADVVLLTASGPALQRITFSPP
FT                   LTRKRQEALRALHYVAASKVFLSFRRPFWHEEHIEGGHSNTDRPSRLIFYPAQGEGSLL
FT                   LASYTWSDAAAPFAGLSTDQTLRLVLQDVAALHGPVVFRLWDGRGVVKRWAEDPHSQGG
FT                   FVVRPPLYGREAEDYDWSAPFGRIYFAGEHTALPHGWVETAVKSGLRAAVRINNNYGYG
FT                   EVDPQMMEHAYAEANYLDQYPEGERPEQQQAREEVSPDEQEPSHKHLLVETSPEGQQHA
FT                   FVEAIPELQGHVFVETVPQEKGHAHQNIYPSEHVQVHGEVIPEWHGHGGSGTPQMHRVG
FT                   DHS"
XX
SQ   Sequence 2299 BP; 529 A; 643 C; 709 G; 418 T; 0 other;
     gactcactcc atggcggcga aaaggcgagg aggcaacggc ggcggcggcc tcggctgaag        60
     agacggtgtg agcggagagt gaaggcgcgg aagaacacag gcagatgccc tgccttgctg       120
     accggtctca ttaaatcacc atgaagacag caaaggacct ggcttctctg gcctagcaag       180
     gctgtaggag aaagctatca ttcatcctgg ttctgcctgc gctaaaggat gacctcagtt       240
     ccaggctgac cagcaaggcc atgggcgcca ggagagcccc acaaagacca ccatgcaccc       300
     tgcgtcttgt cctggcggcc accctccttg gtctggcagg ctctctggac tggaaggcag       360
     cctccagctt gaaccctatt gagaagtgta tggaggacca cgattatgag cagctactca       420
     aggtggtgac cttgggcctc aatcggactt cgaagcccca gaaggtggta gtggttggtg       480
     caggcgtggc agggctggta gcagccaaga tgctcagtga tgcaggacac aaggtcacca       540
     tcctggaggc agataacagg attgggggcc gtatcttcac tttccgggat gagaagacag       600
     gctggatagg ggagcttggg gccatgcgaa tgcccagctc tcacaggatc ttgcacaagc       660
     tctgcaggac cctgggcctc aacctgactc agttcacaca gtatgatgag aacacgtgga       720
     cggaggtgca taatgtgaag ctgcgaaact atgtggtgga gaagatgcca gaaaagctgg       780
     gctacaacct gaacaacagg gaaaggggcc attccccaga ggacatctac cagatggcac       840
     tcaacaaggc cttcaaagac ctcaaggcct tgggctgcaa gaaagccatg aataagttca       900
     acaagcatac gcttctggaa tacctcctcg aggagggcaa cctgtcccgg ccggctgtgc       960
     agctcctggg agatgtgatg tccgaggagg gcttcttcta cctcagcttt gcagaagcct      1020
     tacgtgcgca cgcctgcctg agcgatagac tccggtacag ccgcatcgta ggtggctggg      1080
     acctgcttcc gcgagctctg ctgagctcac tgtccggggc gctgctactg aacgcgcctg      1140
     tggtgtcgat cactcagggg aggaacgatg tgcgcgtgca cattgccacc tcgcttcaca      1200
     gcgagaagac gctgacagcc gacgtggtgc tgctgactgc cagtggaccc gcgctgcagc      1260
     gcattacctt ctcgccgccc ttgactcgca agaggcagga ggcactgcgc gcgcttcact      1320
     acgtagcagc cagcaaggtt tttctgagtt tccgtcggcc cttctggcac gaggagcaca      1380
     tcgagggcgg ccactccaac actgaccgcc catcgcgcct catattctat cccgcgcagg      1440
     gcgagggctc actgcttctg gcctcctaca cgtggtcgga cgctgcagcc cccttcgctg      1500
     gactgagcac cgaccagacc ctgcgtttgg tgctccagga cgtggcggcc ctgcacgggc      1560
     ctgtggtgtt ccggctgtgg gacggcaggg gtgtggtcaa gcgctgggca gaggacccgc      1620
     atagccaggg aggcttcgtg gtgcggccgc cattgtacgg gcgcgaggct gaggactatg      1680
     actggtcagc ccccttcggc cgcatttact tcgcgggcga gcacacagct ctcccgcatg      1740
     gctgggtaga gaccgctgtc aagtccgggt tgcgggccgc ggtgagaatc aataataact      1800
     atgggtacgg ggaggtcgac ccccagatga tggagcatgc atatgcagag gccaactatc      1860
     tggaccagta tcctgaaggg gagaggcccg agcagcagca ggcgcgggaa gaagtcagcc      1920
     cagatgaaca ggagccctct cacaaacact tgttggtgga aacgagcccc gaggggcagc      1980
     aacacgcgtt tgtggaggcc attcccgagc tgcagggaca cgtgttcgtg gagactgtcc      2040
     cccaggagaa ggggcacgcc caccagaata tatatccttc ggagcatgta caggtgcatg      2100
     gggaagtcat ccctgagtgg catggtcatg ggggatctgg caccccgcaa atgcaccgag      2160
     tgggggacca ctcctaatcg caaagaggaa gtgagcaccc agctcctaag ccagccctct      2220
     tcagggcaga cagaccacct acactaatag cccacaataa agttattttt gttaaaaaaa      2280
     aaaaaaaaaa aaaaatagt                                                   2299
//