spacer

EBI Dbfetch

ID   AK133006; SV 1; linear; mRNA; HTC; MUS; 4559 BP.
XX
AC   AK133006;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus adult male testis cDNA, RIKEN full-length enriched library,
DE   clone:4930550O03 product:solute carrier family 12, member 6, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4559
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 47c2cf8ed6be7384373d812fcdc8469b.
DR   Ensembl-Gn; ENSMUSG00000027130; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110991; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=4930550O03
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4559
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="4930550O03"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10090"
FT   CDS             999..4385
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="solute carrier family 12, member 6 (MGD|MGI:2135960
FT                   GB|AF211854, evidence: BLASTN, 99%, match=3353)"
FT                   /db_xref="GOA:Q3V0N8"
FT                   /db_xref="InterPro:IPR000076"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="InterPro:IPR004842"
FT                   /db_xref="InterPro:IPR018491"
FT                   /db_xref="MGI:MGI:2135960"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V0N8"
FT                   /protein_id="BAE21466.1"
FT                   /translation="MHPPEATTKMSSVRFMVTPTKIDDIPGLSDTSPDLSSRSSSRVRF
FT                   SSRESVPETSRSEPMSELSGATTSLATVALDPSSDRTSNPQDVTEDPSQNSITGEHSQL
FT                   LDDGHKKARNAYLNNSNYEEGDEYFDKNLALFEEEMDTRPKVSSLLNRMANYTNLTQGA
FT                   KEHEEAENITEGKKKPTKSPQMGTFMGVYLPCLQNIFGVILFLRLTWVVGTAGILQAFA
FT                   IVLICCCCTMLTAISMSAIATNGVVPAGGSYFMISRALGPEFGGAVGLCFYLGTTFAAA
FT                   MYILGAIEIFLVYIVPRAAIFRSDDALKESAAMLNNMRVYGTAFLVLMVLVVFIGVRYV
FT                   NKFASLFLACVIVSILAIYAGAIKSSFAPPHFPVCMLGNRTLSSRHLDICSKTKEVDNM
FT                   TVPSKLWGFFCNSSQFFNATCDEYFVHNNVISIQGIPGLASGIITENLWSNYLPKGEII
FT                   EKPSAKSSDVLGNLNHEYVLADITTSFTLLVGIFFPSVTGIMAGSNRSGDLKDAQKSIP
FT                   IGTILAILTTSFVYLSNVVLFGACIEGVVLRDKFGDAVKGNLVVGTLSWPSPWVIVIGS
FT                   FFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLRVFGHSKANGEPTWALLLTAAIAELGIL
FT                   IASLDLVAPILSMFFLMCYLFVNLACALQTLLRTPNWRPRFRYYHWALSFMGMSICLAL
FT                   MFISSWYYAIVAMVIAGMIYKYIEYQGAEKEWGDGIRGLSLSAARFALLRLEEGPPHTK
FT                   NWRPQLLVLLKLDEDLHVKHPRLLTFASQLKAGKGLTIVGSVIVGNFLENYGDALAAEQ
FT                   TIKHLMEAEKVKGFCQLVVAAKLKEGISHLIQSCGLGGMKHNTVVMGWPNGWRQSEDAR
FT                   AWKTFIGTVRVTTAAHLALLVAKNVSFFPSNVEQFSEGNIDVWWIVHDGGMLMLLPFLL
FT                   KQHKVWRKCSIRIFTVAQLEDNSIQMKKDLATFLYHLRIEAEVEVVEMHDSDISAYTYE
FT                   RTLMMEQRSQMLRHMRLSKTERDREAQLVKDRNSMLRLTSIGSDEDEETETYQEKVHMT
FT                   WTKDKYMASRGQKVKSMEGFQDLLNMRPDQSNVRRMHTAVKLNEVIVNKSHEAKLVLLN
FT                   MPGPPRNPEGSSLCKAAFGWS"
XX
SQ   Sequence 4559 BP; 1105 A; 1144 C; 1153 G; 1157 T; 0 other;
     gaaacaacag ctgcgcgcgc acccgcatca gctggcgcgg gctcccgcac ctgcgacctc        60
     ctccgtagcc gggaccagcc tgcctggccg tcttctccct ccgccgagac ccaaggaaag       120
     ccggcgagag gctaacgggc cccgggagga aagcgcgtcc tgtcacacgc agtgcaaaca       180
     cggcgagcgg tcgtgggctt gagggactcg ccacgacctg ccacgaccct gcagtgggag       240
     ctgccctgat ccgctagccg ccgcctccag ctcctttgcc aggacgagac ctctgggagg       300
     caggaatcca ctctgcttcg gcatcctctc gtggctctcc tctttctcct tcctgtagtg       360
     tgggggtatt ttcccgttat gcatgcgcat ctctcccacc agacccaagt ggattatcga       420
     cctcaaaaac atcgggtggc tcagcacaca cctcctccca gccagacctg tggggtattc       480
     acctgataca caacaggtgg ctggtgcaca cctttgcgca atctgatcca cgctcttata       540
     cgcctgataa gggtgggcct gcatgctccg tcctcagcta gaaccgtggg acactcggca       600
     gataaaggac taactacctc atccggaccc tgggggttga gcagagggag gcgtcaccag       660
     ctgctgtgag atcatggcac ggagccctca gccctggacc aggggagata gctaggattc       720
     tgaaagaacc aagttataca ggattagcat cgttttgttc ttattttgtt ttctcgaaaa       780
     ttatttttca gttactggtg gggcacttta taaaacagct ggcttgaatt ctatacacgg       840
     attcttaatt gggcctttgt gggctgtaaa tcagggtaat tgagggtttt tggttttttt       900
     tccccttcta tttttgcaat cagaagtagc tagtgtagga ggaagagttt ttgtgagctt       960
     ttcctttttt ctttgtcaaa aaggaaaggg gggggaaaat gcatccacca gaagccacca      1020
     ccaagatgtc ctcagttcgg ttcatggtga caccaactaa gattgatgac attccaggtt      1080
     tgtcagacac cagcccggac ctcagctctc ggtctagttc tcgagtaaga tttagctccc      1140
     gagaaagtgt gccagaaaca agccgtagtg agcctatgag cgaactgtct ggggctacta      1200
     cttctctggc aactgttgcc ctagatcctt ccagtgaccg gacttctaat ccccaggatg      1260
     ttacggagga cccgagtcag aactccatca caggggagca cagccagctg ttagatgacg      1320
     gccataaaaa agcccgaaat gcttatctca ataattccaa ctatgaagaa ggagacgaat      1380
     attttgataa aaatttggca ctctttgagg aagaaatgga caccagacca aaggtgtctt      1440
     ctctcctcaa ccgcatggcc aactatacaa atctgacaca aggagcaaag gaacatgaag      1500
     aggcagagaa catcactgaa gggaaaaaga agcctaccaa gagcccccaa atgggtactt      1560
     tcatgggtgt ctacctccca tgtctacaga acatctttgg agtgatcctc ttcctgcgtc      1620
     ttacctgggt agtgggaaca gctggaatcc ttcaggcctt tgcaattgtc ctcatctgct      1680
     gctgctgtac aatgttaact gccatctcca tgagcgccat cgccactaac ggagtggtgc      1740
     cagctggggg ctcatacttc atgatttcca gagccctggg cccagagttt ggcggggctg      1800
     taggcctctg cttttatctt ggcaccacat ttgcagcagc catgtatatt cttggtgcca      1860
     ttgaaatctt tctggtatac attgtccccc gagctgccat ctttcggagt gacgatgcac      1920
     tcaaggagtc agcagctatg ctgaacaaca tgcgcgtcta tggtacagcc ttcttggtcc      1980
     tcatggtctt ggtggtattc atcggcgtac gctatgtgaa taagtttgcc tcactcttcc      2040
     tggcctgtgt aattgtgtcg atcttggcta tctatgctgg tgccatcaag tcttcctttg      2100
     ctccaccaca cttcccggtc tgtatgctgg gcaaccgtac cctgtcatca agacaccttg      2160
     acatttgctc taagaccaag gaggttgaca acatgacagt accatcaaag ttatggggat      2220
     tcttctgcaa ctcgagtcag ttctttaatg ccacctgtga tgagtacttt gttcacaata      2280
     acgtcatctc aatccaaggc attccagggt tggctagtgg tatcattact gaaaatcttt      2340
     ggagtaatta tttaccaaag ggtgagataa ttgaaaagcc atcagccaag tcatctgatg      2400
     tcttaggcaa cttaaaccat gaatatgttc ttgctgatat caccacctcc ttcactctgc      2460
     tggtggggat cttctttccc tcggtcacag gtatcatggc tgggtcaaac agatctggag      2520
     atctgaaaga tgcccagaag tctattccca ttgggaccat ccttgccatc ctgaccacat      2580
     cctttgtgta tttaagcaat gttgtccttt ttggtgcatg tattgaagga gtcgttctca      2640
     gagacaaatt tggggatgct gtaaaaggga atttggttgt aggcacctta tcctggccat      2700
     ccccgtgggt gatcgttatt ggctccttct tttcaacatg tggggctggg ctgcagagcc      2760
     tcacaggtgc gcctcggctg ctgcaggcta tcgccaagga taacatcata cctttcctta      2820
     gggtttttgg tcacagcaaa gctaatgggg aacctacctg ggctttactt ctaactgctg      2880
     ccatagcaga gctgggaatt ctcatcgcct ccctggatct cgtggcccca attctttcca      2940
     tgttttttct catgtgttac ctctttgtga acttggcttg tgccttgcaa acattgctgc      3000
     gaacccccaa ctggaggcct cgattccgct attatcactg ggccctctct ttcatgggaa      3060
     tgagtatctg tctagctctg atgttcattt cttcttggta ttatgccatt gtagctatgg      3120
     taatagctgg catgatctac aagtacattg aatatcaagg ggctgagaaa gaatgggggg      3180
     atggtatccg tgggctgtcg ctcagtgcag cccgcttcgc tttgctccgt ctagaggaag      3240
     gacctcctca cactaaaaac tggaggcctc agctgctcgt cctactgaag ctggatgaag      3300
     atttacacgt caagcaccct cgcctcctca cctttgcctc ccagctcaag gcaggaaagg      3360
     gactcacgat tgtgggctct gtcatcgtgg ggaacttctt ggagaactat ggtgacgcgc      3420
     tcgcggcaga gcagaccatt aagcacctaa tggaggcaga aaaggtaaaa ggattctgcc      3480
     aattggtggt ggctgccaag ctgaaagagg gcatttcaca cctcatccag tcctgtggcc      3540
     tcggaggcat gaaacacaac acagtggtga tgggctggcc caatggctgg cgtcagagtg      3600
     aagatgctcg cgcttggaag actttcattg gcacagtacg agtgacaact gctgcccatc      3660
     tagccctgct ggtggctaaa aatgtctcct tctttcccag caatgtggag cagttttctg      3720
     agggcaacat tgatgtgtgg tggattgtgc atgatggggg catgctcatg ctattaccgt      3780
     tcctgctgaa acagcacaag gtttggcgga aatgcagcat acggatcttc acagtagccc      3840
     aactagaaga caacagtatc cagatgaaga aggatctggc cacctttctg taccacctgc      3900
     gcattgaggc agaagtggaa gtggtggaga tgcacgacag tgacatatct gcctatacat      3960
     atgagcgcac cctgatgatg gagcagaggt cccagatgct tcggcatatg cggctgtcca      4020
     aaacagagcg agacagggag gcacagctgg tgaaagatcg aaactcaatg ctacgcttga      4080
     ccagcattgg ctctgatgag gacgaagaga cagaaacgta ccaggagaag gtgcacatga      4140
     cttggaccaa ggataaatac atggcatccc gggggcaaaa ggtcaagtca atggaaggat      4200
     tccaggacct acttaatatg cgtccggacc agtccaacgt gagacggatg catacagcag      4260
     tgaagctcaa tgaagttata gtcaacaagt ctcatgaagc aaagctggtt ttgttgaata      4320
     tgccaggacc accccggaac cctgaaggat cctcgctctg caaagctgct tttggatgga      4380
     gttaggtaag aagcacttga aacttgttaa tggaactgag aaaaagacca aggattctgc      4440
     ttcatcccag ggttgctttt atgggaaacc tcccagccct gcagtgacag gactggctca      4500
     ttcttagcaa caccattgag gaaaacaggg gttgttttat taatgaagaa actggtacg       4559
//


spacer
spacer