Dbfetch

ID   AK132901; SV 1; linear; mRNA; HTC; MUS; 2370 BP.
XX
AC   AK132901;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus adult male testis cDNA, RIKEN full-length enriched library,
DE   clone:4930505K17 product:glutamate receptor, metabotropic 1, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2370
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; e975120c537bd850e5edf5382b134375.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=4930505K17
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2370
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="4930505K17"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..2231
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /note="glutamate receptor, metabotropic 1 (MGD|MGI:1351338
FT                   GB|NM_016976, evidence: BLASTN, 100%, match=2369)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q3V0U2"
FT                   /db_xref="InterPro:IPR000162"
FT                   /db_xref="InterPro:IPR000337"
FT                   /db_xref="InterPro:IPR001256"
FT                   /db_xref="InterPro:IPR011500"
FT                   /db_xref="InterPro:IPR017978"
FT                   /db_xref="InterPro:IPR017979"
FT                   /db_xref="InterPro:IPR019588"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:1351338"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V0U2"
FT                   /protein_id="BAE21411.1"
FT                   /translation="SFVGVSGEEVWFDEKGDAPGRYDIMNLQYTEANRYDYVHVGTWHE
FT                   GVLNIDDYKIQMNKSGMVRSVCSEPCLKGQIKVIRKGEVSCCWICTACKENEFVQDEFT
FT                   CRACDLGWWPNAELTGCEPITIRYLEWSDIESIIAIAFSCLGILVTLFVTLIFVLYRDT
FT                   PVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQRLLVGLSSAMCYSALVTKT
FT                   NRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTLVVTLIIMEPPMPILSYPS
FT                   IKEVYLICNTSNLGVVAPVGYNGLLIMSCTYYAFKTRNVPANFNEAKYIAFTMYTTCII
FT                   WLAFVPIYFGSNYKIITTCFAVSLSVTVALGCMFTPKMYIIIAKPERNVRSAFTTSDVV
FT                   RMHVGDGKLPCRSNTFLNIFRRKKPGAGNANSNGKSVSWSEPGGRQAPKGQHVWQRLSV
FT                   HVKTNETACNQTAVIKPLTKSYQGSGKSLTFSDASTKTLYNVEEEDNTPSTHFSPPSSP
FT                   SMVVHRRGPPVATTPPLPPHLSAEETPLFLADSVIPKGLPPPLPQQQQQPPPQPPPQQP
FT                   KSLMDQLQGVVTNFGSGIPDFHAVLAGPGTPGNGLRSLYPPPPPPQHLQMLPLQLSTFR
FT                   EEPISPPGEDDDDDSSERFKLLQEFVYEREGNTEEDDLEEEEDLPAASKLTPEDSPALT
FT                   PPSPFRDSVASGSSVPSSPVSESVLCTPPNVTYASVILRDYKQSSSTL"
XX
SQ   Sequence 2370 BP; 555 A; 682 C; 614 G; 519 T; 0 other;
     gctcttttgt tggagtgtct ggagaggagg tctggttcga tgagaagggg gatgcacctg        60
     gaaggtatga cattatgaat ctgcagtaca cagaggctaa tcgctatgac tatgtccatg       120
     tgggaacctg gcatgaaggt gtgctgaata tcgatgatta caaaatccag atgaacaaaa       180
     gcggaatggt acgatctgtg tgcagcgagc cttgcttaaa gggtcagatt aaggtcatac       240
     ggaaagggga agtgagctgc tgctggatct gcacagcctg caaagagaat gagtttgtgc       300
     aagatgagtt tacctgcaga gcctgtgacc tggggtggtg gcccaatgca gagctcacag       360
     gctgtgagcc cattactatc cgttacctcg agtggagtga catagaatcc atcatagcca       420
     tcgccttttc ttgcctgggc atcctcgtga cgctatttgt caccctcatc tttgtgctgt       480
     accgggacac acctgtggtc aaatcctcca gtagagagct ctgctatatc attctggctg       540
     gtattttcct cggctacgta tgccctttca ccctcatcgc caaacctact accacatcct       600
     gctacctcca gcgcctccta gttggcctct cttctgccat gtgctactct gctcttgtga       660
     ccaaaaccaa tcgtattgca cgcatcctgg ctggcagcaa gaagaagatc tgtacccgga       720
     agcccaggtt catgagcgct tgggcccaag tgatcatagc ctccattctg attagtgtac       780
     agctgacact agtggtgacc ttgatcatca tggagcctcc catgcccatt ttgtcctacc       840
     cgagcatcaa ggaagtctat cttatctgca ataccagcaa cctgggtgta gtggcacctg       900
     tgggttacaa cggacttctc atcatgagct gtacctacta tgccttcaag acccgcaacg       960
     tgccggccaa tttcaatgag gctaaataca tcgccttcac tatgtacacc acctgcatca      1020
     tctggctggc ttttgttccc atttactttg ggagcaacta caagattatc actacctgct      1080
     tcgcagtgag cctcagtgtg acggtggccc tgggctgcat gttcactccc aagatgtaca      1140
     tcattattgc caaacccgag aggaatgtcc gcagtgcctt caccacctct gatgtagtgc      1200
     gcatgcacgt cggtgacggc aagctgccat gccgctccaa caccttcctc aacattttcc      1260
     ggagaaagaa gcctggggca gggaacgcca attctaacgg caagtctgtg tcatggtctg      1320
     aaccaggtgg aagacaggcg cccaagggac agcatgtgtg gcagcgcctc tctgtgcacg      1380
     tgaagaccaa tgagacggcc tgtaaccaaa cagccgtaat taaacccctc actaaaagtt      1440
     accaaggctc tggcaagagt ctgacctttt cagacgccag caccaagacc ctttacaacg      1500
     tggaggaaga ggacaatacc ccttcaactc acttcagccc tcccagcagc ccttccatgg      1560
     tggtgcaccg acgcgggcca cccgtggcca ccacgccacc tctgccaccc caccttagcg      1620
     cagaagagac gcccttgttc ctggctgatt ctgtcatccc caagggcttg cctcctcctc      1680
     tcccgcagca gcaacagcag ccgccccctc agccgcctcc gcagcagccc aaatccctga      1740
     tggaccagct gcaaggcgtg gtcaccaact ttggctctgg gattccagac ttccacgcgg      1800
     tgctggcagg cccggggaca ccagggaacg ggctgcgctc cctgtacccg cccccgcctc      1860
     caccgcaaca cctgcagatg ttgcccctgc agctgagcac cttccgagag gagcccatct      1920
     cccctccggg ggaggacgac gatgatgaca gcagcgagag gttcaagctc ctgcaggagt      1980
     tcgtgtatga gcgtgaaggg aacacggagg aagacgatct ggaagaggag gaggacctgc      2040
     ctgcagccag caagctgacg cctgaggatt cgcctgccct gacgccccct tctcctttcc      2100
     gagattccgt ggcctctggc agctcagtgc ccagttcccc agtgtctgag tcagtgctct      2160
     gcacccctcc aaatgtgacc tatgcctctg tcattctgag ggactacaag caaagctctt      2220
     ccactctgta gtaagggggg agtatgcgtg gagaagccag agatgccaag gagtgtcaac      2280
     cctttcagaa atgtgtagaa agcaaggggg tggggtggga tggaggacca cagtctgcag      2340
     ggaagaaaaa aaagaaaaga aaaggaaagg                                       2370
//