spacer

EBI Dbfetch

ID   AK132627; SV 1; linear; mRNA; HTC; MUS; 1173 BP.
XX
AC   AK132627;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus 0 day neonate head cDNA, RIKEN full-length enriched library,
DE   clone:4833435C14 product:antimicrobial peptide RYA3, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1173
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; f0f898a4f3089835d238e6e6b1e43889.
DR   Ensembl-Gn; ENSMUSG00000068008; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000088950; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109760; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=4833435C14
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1173
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="0 day neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="4833435C14"
FT                   /tissue_type="head"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..914
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /note="antimicrobial peptide RYA3 (MGD|MGI:2675077
FT                   GB|NM_194357, evidence: BLASTN, 100%, match=1173)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q3V181"
FT                   /db_xref="InterPro:IPR001124"
FT                   /db_xref="InterPro:IPR017943"
FT                   /db_xref="MGI:MGI:2675077"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V181"
FT                   /protein_id="BAE21270.1"
FT                   /translation="MSGLLPTPIFGLVEQTLCKVLPGLLCPVVDSVLSVVNELLGATLS
FT                   LVPLGPLGSVEFTLATLPLISNQYIELDINPIVKSIAGDVIDFPKPRIPVKVPPKEDHT
FT                   SQVTVPLYLFSTVFGLLQTNGALDLDITPEMVPRNVPLTTTDLAALAPEALGKLPPAQH
FT                   LLLSLRVTKSPMVLLQNKKATVSIPVTIHVLSSVPQGTPVALFQLNGVMTLNAHLAPSS
FT                   TKLHISLSLERLSVQLASSFPQPFDASRLEEWLSDVVRAAYMQRLNEHLEVGIPLPKIL
FT                   NVNFANSVVDIIENAVVLTVAP"
FT   polyA_signal    1150..1155
FT                   /note="putative"
FT   polyA_site      1173
FT                   /note="putative"
XX
SQ   Sequence 1173 BP; 228 A; 359 C; 283 G; 303 T; 0 other;
     tgatgtcagg gctgctgccc acgccaatct ttgggctcgt agaacagaca ctgtgcaagg        60
     tgctgcctgg actgctgtgc cctgtggtag acagtgtgct gagtgtggtg aatgagctct       120
     tgggagctac gctgagcctg gtgccccttg ggcctctggg gtctgtggag ttcactctgg       180
     ctacacttcc cctaatctcc aaccagtaca ttgagctgga tataaatccc atcgtgaaga       240
     gcatagctgg agatgtcatt gatttcccca agccacgcat cccagtcaag gtgcccccca       300
     aagaggacca cacctcccaa gtgactgtcc cactctatct cttcagcacc gtgtttgggc       360
     tcctgcaaac caacggtgcc cttgacctgg acatcacccc tgagatggtt cccaggaatg       420
     tccctctgac aactactgac ctggcagctt tggctcctga ggccctgggg aaactgcccc       480
     ctgctcagca cctcctgctc tcgctgcggg tgacaaaatc gcccatggtc ctgctgcaga       540
     acaagaaggc cacagtctcc atcccagtca ccatccatgt gctgtcttct gtccctcaag       600
     gaactcctgt agcccttttc cagttgaatg gggttatgac tctaaatgcc cacctggctc       660
     catcctctac caagctgcac atatctctgt ccctggaacg gctaagtgtc cagctggcct       720
     cctcctttcc ccaacctttt gatgcatccc gtctggaaga atggctcagt gatgtggtcc       780
     gggctgccta catgcagagg ctcaacgagc acctggaggt tggaattccc ctgcctaaga       840
     ttctcaatgt caactttgcc aattcagtgg tcgatatcat tgagaatgca gttgtgctca       900
     cagtggctcc gtgaggcggt atggctgctg ctctccctgt tcactacaga gtcctatctg       960
     tctgcccact ctgcctcagt ttccctccca gtcttaagcc tgcattggtg acagtataag      1020
     tgccccttgc ccacccgggc ccaccttgcc ctctgttcct gtgatcatgc ctgttttggg      1080
     gtggggatgg ctggatagcc actgatctgc ttcagaaagc acatagcacc ttggttcaat      1140
     cccagcttta ataaactgat ccttggtctt gtg                                   1173
//


spacer
spacer