spacer

EBI Dbfetch

ID   AK132092; SV 1; linear; mRNA; HTC; MUS; 1363 BP.
XX
AC   AK132092;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus 12 days embryo head cDNA, RIKEN full-length enriched library,
DE   clone:3021402K16 product:baculoviral IAP repeat-containing 1a, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1363
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 8529125bf27eec5e12b83f252f32f2fb.
DR   Ensembl-Gn; ENSMUSG00000021640; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022142; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=3021402K16
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1363
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="12 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="3021402K16"
FT                   /tissue_type="head"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..326
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /note="baculoviral IAP repeat-containing 1a
FT                   (MGD|MGI:1298223 GB|AF135491, evidence: BLASTN, 99%,
FT                   match=1362)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q3V221"
FT                   /db_xref="MGI:MGI:1298223"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V221"
FT                   /protein_id="BAE20978.1"
FT                   /translation="LDLSMNHKITEEGYRNFFQALDNLPNLQNLNICRHIPECIQVQAT
FT                   TVKALGQCVSRLPSLTRLHMLSWLLDEEDMKVINDVKERHPQSKRLIIFWKWIVPFSPV
FT                   VLE"
FT   polyA_signal    1346..1351
FT                   /note="putative"
FT   polyA_site      1363
FT                   /note="putative"
XX
SQ   Sequence 1363 BP; 400 A; 288 C; 295 G; 380 T; 0 other;
     agttagatct ttccatgaat cacaagatta ccgaggaagg atatagaaat ttctttcaag        60
     ccctggacaa cctgccaaac ttgcagaatc tgaacatctg cagacatatc ccagaatgca       120
     ttcaagttca ggccaccact gtcaaggctc tgggtcaatg tgtgtcccga ctgcccagcc       180
     tcactaggct gcacatgctc agttggctcc tggatgaaga ggacatgaaa gtgattaatg       240
     atgtgaagga aagacacccc cagtccaaac gcttgattat cttctggaaa tggatagtcc       300
     cgttctctcc tgttgtcctg gagtaaagga tgctcctgaa gactactgat agttcagaat       360
     accagatttc ctaaaacact ttactttagc tgggcatggt ggtacacacc tgtactttca       420
     acatttagga cactgatgtg caagaatcaa gaagttcaga ccagatccag tttcacagct       480
     aaagacacaa ctatccatcc tactaaagaa tatttattaa gtgtgcagac tgctaatttt       540
     ttttcagaag tctgcatgcc cactattgaa ttcagtagct atattgctca atgccttggc       600
     agtccttatt tggtcttcct gtctgaagac tagagcctca gtcacgttca tatagagaac       660
     tgtcaatgcc aaggtcaaca ggaaggcgct gggaaaggaa catcgatcta tgtagaagcc       720
     acatccggaa gtagtatttg ataggtgctg gggtagtgca agaggaacag caaaacagct       780
     ttagaactca cggaacgcag tctcctggtt agcacaaact catgggtggg tctccgagag       840
     aactatgggt cctgagagct tcatggtgtc atagagattt gctctgcttg ctgccttctc       900
     actgtgttac tcataatcta tgagttttat gaactctcta gggggcttaa caacccctca       960
     ctgggcagtg tcattgtcac tcacagcagc agtgcttgat cttcaagatc aatgattcaa      1020
     tcaccaccct tggaaagaac ttagaaatgt acattgttag aaatgaccac cagtcttaag      1080
     aatttggaga agtagattgt cagtaaagtt aggttaagat gtttttgtta atggctctga      1140
     tgttgaaaaa tcttagaaat caaatagaaa ttcagaaaag cccacttttg attattgatc      1200
     aagggatgtt ttcaagatca ggaacaagaa caatggcagc tcagctagca ctggctgatg      1260
     tgactcttgc tgaagctggg ctgatgatcg aggtgataat taatgtcttg tacccaatgt      1320
     tcccctcacc tttctgataa gatttaataa aaagttgtcc cct                        1363
//


spacer
spacer