spacer

EBI Dbfetch

ID   AK132030; SV 1; linear; mRNA; HTC; MUS; 301 BP.
XX
AC   AK132030;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus adult male hippocampus cDNA, RIKEN full-length enriched
DE   library, clone:2900001K03 product:clusterin, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-301
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; a0f8ae3b29b87b6d8123d456a2f7ca61.
DR   Ensembl-Gn; ENSMUSG00000022037; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022616; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000127387; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000128539; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000138191; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000144619; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000153460; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=2900001K03
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..301
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="2900001K03"
FT                   /tissue_type="hippocampus"
FT                   /db_xref="taxon:10090"
FT   CDS             74..>301
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="clusterin (MGD|MGI:88423 GB|NM_013492, evidence:
FT                   BLASTN, 100%, match=300)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3V245"
FT                   /db_xref="InterPro:IPR000753"
FT                   /db_xref="InterPro:IPR016016"
FT                   /db_xref="MGI:MGI:88423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V245"
FT                   /protein_id="BAE20954.1"
FT                   /translation="MKILLLCVALLLIWDNGMVLGEQEVSDNELQELSTQGSRYINKEI
FT                   QNAVQGVKHIKTLIEKTNAERKSLLNSLEEA"
XX
SQ   Sequence 301 BP; 88 A; 77 C; 85 G; 51 T; 0 other;
     gacccgcgtc accaggagga gcgcactgga gccaagccgc agaccggact ccagattcca        60
     aggaggccac gccatgaaga ttctcctgct gtgcgtggca ctgctgctga tctgggacaa       120
     tggcatggtc ctgggagagc aggaggtctc tgacaatgag ctccaagaac tgtccactca       180
     agggagtagg tatattaata aggagattca gaacgccgtc cagggagtga agcacataaa       240
     aactctcata gaaaaaacca acgcagagcg caagtccttg ctcaacagtt tagaggaagc       300
     c                                                                       301
//


spacer
spacer