spacer

EBI Dbfetch

ID   AK131788; SV 1; linear; mRNA; HTC; MUS; 1640 BP.
XX
AC   AK131788;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus adult male testis cDNA, RIKEN full-length enriched library,
DE   clone:1700119G06 product:Pbx/knotted 1 homeobox, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1640
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 8e322ede94d8a4a50e6bc566b8b38db9.
DR   Ensembl-Gn; ENSMUSG00000006705; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097352; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000175806; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000176701; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=1700119G06
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1640
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="1700119G06"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10090"
FT   CDS             203..1513
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="Pbx/knotted 1 homeobox (MGD|MGI:1201409 GB|AF061270,
FT                   evidence: BLASTN, 98%, match=1497)"
FT                   /note="putative"
FT                   /db_xref="GOA:O70477"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR008422"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="MGI:MGI:1201409"
FT                   /db_xref="UniProtKB/Swiss-Prot:O70477"
FT                   /protein_id="BAE20805.1"
FT                   /translation="MMATQTLSIDSYQDGQQMQVVTELKTEQDPNCSDPDAEGVSPPPI
FT                   ESQTPMDADKQAIYRHPLFPLLALLFEKCEQSTQGSEGTTSASFDVDIENFVRKQEKDG
FT                   KPFFCEDPETDNLMVKAIQVLRIHLLELEKVNELCKDFCSRYIACLKTKMNSETLLSGE
FT                   PGSPYSPVQSQQIQSAITGTLSPQGIVVPASALQQGNVTMATVAGGTVYQPVTVVTPQG
FT                   QVVTQALSPGTIRIQNSQLQLQLNQDLSILHQEDGSSKNKRGVLPKHATNVMRSWLFQH
FT                   IGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRILQPMLDSSCSETPKTKKKPAQNR
FT                   PVQRFWPDSLASGVAQATPSELAMSEGAVVTITTPVNMNVDSLQSLSSDGATLAVQQVM
FT                   MAGQSEDESVDSTEDEGGALAPTHISGLVLENSDSLQ"
XX
SQ   Sequence 1640 BP; 441 A; 413 C; 429 G; 357 T; 0 other;
     gaaggagggt ttgcttagag ttcagggatt gcccctccac gtaaaaggat ccagttttta        60
     gatattacat aatgctctgg gctaaaagac aaggcatgct gagtaaggaa gtgctaactg       120
     gtgctcttct ctcgtatttc cctagacacc gtgtgcttct cgctcaagat gatctgatgt       180
     ctgaagtgga ctctcactaa ccatgatggc gacacagacg ctaagtatag acagctatca       240
     agatggacag caaatgcagg tggtcacgga gttaaaaaca gagcaagatc ccaactgctc       300
     tgacccagat gcagaaggag tgagtcctcc tcccatcgag tctcagaccc caatggatgc       360
     cgacaagcag gccatttata ggcatccact atttccgttg ctagctttgt tgtttgagaa       420
     gtgtgagcag tccacacagg gctcagaagg cacgacgtct gccagcttcg atgtggacat       480
     tgagaacttt gtcaggaagc aagaaaagga tgggaaaccc ttcttctgtg aagatccgga       540
     aactgacaac ctaatggtga aagcaatcca ggtcctgcgc attcatcttc ttgaactgga       600
     gaaggttaat gagctctgta aagatttctg tagtcggtac attgcttgtc tgaagacaaa       660
     aatgaacagc gagaccttgt tgagtgggga gcctggaagt ccgtactccc ctgtgcaatc       720
     ccagcagatt cagagtgcca tcacaggcac gctcagcccc cagggaatcg tggtgccagc       780
     atcagcccta caacagggaa atgtaaccat ggcaacagtg gcaggtggca cagtgtacca       840
     gcctgtcacc gtcgtcactc cgcaaggcca agtggtcacg caggcattat ctcctgggac       900
     aattaggatc cagaactcac agctgcagtt gcagttgaac caagacctca gcatcttgca       960
     tcaagaggat ggctcctcca agaacaagag gggtgtcctg ccgaagcacg ccaccaacgt      1020
     gatgcggtcc tggctctttc agcacatagg gcatccctac ccaacagagg atgagaaaaa      1080
     gcagattgct gctcagacga atctgaccct gcttcaagtc aacaactggt tcatcaacgc      1140
     gagaagacga attctccagc caatgttgga ttccagctgc tcagagactc caaaaacgaa      1200
     gaaaaaacct gctcagaaca ggccagttca gaggttttgg ccagattctc ttgcatcagg      1260
     agtggcacaa gcaacaccca gcgagcttgc catgtcagaa ggtgccgttg tgaccatcac      1320
     cacacctgta aacatgaatg tggacagcct tcagtccctg tcctcagacg gggccaccct      1380
     ggccgtacag caggtcatga tggcagggca gagtgaggac gagtcggtgg atagcacaga      1440
     ggatgagggc ggcgccctgg cgcccacaca catcagcggg ctggtgctgg agaacagcga      1500
     ctcccttcag taggaagcac caacggggtc agtgtggagc tgggcgctgg actcttcact      1560
     gtttgcacag caagcatctt acagttgtct ttgtaacctg ttttatatgt agatatagaa      1620
     ggtgcacttt tgtatttcgc                                                  1640
//


spacer
spacer