Dbfetch

ID   AK131155; SV 1; linear; mRNA; STD; MUS; 4672 BP.
XX
AC   AK131155;
XX
DT   02-JUN-2004 (Rel. 80, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus mRNA for mFLJ00205 protein.
XX
KW   FLI_CDNA.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4672
RA   Okazaki N., Kikuno R., Nagase T., Ohara O., Koga H.;
RT   ;
RL   Submitted (04-FEB-2004) to the INSDC.
RL   Hisashi Koga, Kazusa DNA Research Institute, Laboratory for Genome
RL   Informatics; 2-6-7   Kazusa-kamatari, Kisarazu, Chiba, 292-0818, Japan
RL   (E-mail:mouse@kazusa.or.jp, Tel:81-438-52-3919, Fax:81-438-52-3918)
XX
RN   [2]
RA   Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S.,
RA   Saga Y., Kitamura H., Nakagawa T., Nagase T., Ohara O., Koga H.;
RT   "Prediction of the Coding Sequences of Mouse Homologues of FLJ Genes: The
RT   Complete Nucleotide Sequences of 110 Mouse FLJ-Homologous cDNAs Identified
RT   by Screening of Terminal Sequences of cDNA Clones Randomly Sampled from
RT   Size-Fractionated Libraries";
RL   DNA Res. 11:167-180(2004).
XX
DR   MD5; 737ae50f7402cf0adeb83fa80d6c5891.
DR   Ensembl-Gn; ENSMUSG00000020520; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018338; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0018307; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0018276; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018278; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018090; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018730; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017654; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0018064; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0018173; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0018165; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0018248; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018191; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018772; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017427; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017702; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000066987; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0029217; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0029178; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0029145; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0029159; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0028961; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0029661; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0028637; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0028881; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0029024; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0028995; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0029125; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0028984; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0029695; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0028341; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0028453; mus_musculus_wsbeij.
XX
CC   The CREATE program supported by Japan science and technology
CC   corporation; cDNA full insert sequencing: Kazusa DNA Research
CC   Institute; cDNA library construction, clone selection and 5'- &
CC   3'-end one pass sequencing.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4672
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone="mfj07125"
FT                   /tissue_type="fetal brain"
FT                   /note="vector:modified pBC SK+"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..1907
FT                   /codon_start=3
FT                   /gene="mFLJ00205"
FT                   /product="mFLJ00205 protein"
FT                   /note="CDS is predicted by in silico analysis. Start codon
FT                   is not identified."
FT                   /db_xref="GOA:Q6P9S7"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="MGI:MGI:1890480"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6P9S7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAD21405.1"
FT                   /translation="RPLLLAELLPPPGGRADAQSRGRARRGGPAPMRRKEKRLLQAVAL
FT                   ALAALVLLPNVGLWALYRERQPDGSPGGLGAAVAPAAVQELHSRQKKTFFLGAEQRLKD
FT                   WHNKEAIRRDAQRVGYGEQGKPYPMTDAERVDQAYRENGFNIYVSDKISLNRSLPDIRH
FT                   PNCNSKLYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREH
FT                   LKKPLEDYMALFPSVRILRTKKREGLIRTRMLGASAATGDVITFLDSHCEANVNWLPPL
FT                   LDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPS
FT                   DPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRV
FT                   GHIYRKYVPYKVPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVVAQKKLR
FT                   VSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNVGTGLCTDTKLGTLGSPLRLE
FT                   TCIRGRGEAAWNSMQVFTFTWREDIRPGDPQHTKKFCFDAVSHTSPVTLYDCHSMKGNQ
FT                   LWKYRKDKTLYHPVSGSCMDCSESDHRVFMNTCNPSSLTQQWLFEHTNSTVLENFNKN"
XX
SQ   Sequence 4672 BP; 1041 A; 1315 C; 1342 G; 974 T; 0 other;
     cgcggccgct actgctggcc gaactgctgc cgccgccggg tggacgggcg gacgcgcaaa        60
     gccgggggcg ggcgcggcgg ggcggaccgg ccccgatgag gcgcaaagag aagcggctct       120
     tgcaggcggt ggctctggct ctggcggccc tggtcctgct gcccaacgtg gggctttggg       180
     ctctgtaccg cgagcggcag cccgacggca gccctggggg attgggggcg gcggtggccc       240
     ccgcggcggt tcaggaatta cacagtcgac aaaaaaagac atttttcttg ggagctgaac       300
     aaaggctgaa ggactggcat aacaaggagg ctatcaggag ggacgcacag cgcgtaggat       360
     atggagaaca ggggaagcct taccccatga ccgatgccga gagagtggac caggcgtacc       420
     gggaaaatgg atttaacatc tacgtcagtg ataaaatctc cctgaatcgc tctctccccg       480
     atatccggca cccaaactgt aacagcaagc tctacctgga gacgctcccc aacaccagca       540
     tcatcatccc cttccacaac gagggctggt cctcactgct gcgcactgtt cacagcgtgc       600
     tcaaccgctc gcccccagag ctagtggcgg agattgtgtt ggttgatgac ttcagtgatc       660
     gagagcacct gaagaagccc ctggaggact acatggccct tttccccagc gtgaggattc       720
     tccggaccaa gaaacgggaa ggcctgataa ggacccgaat gctgggggca tcagccgcca       780
     ccggagatgt catcactttc ttagattcac actgtgaagc caacgtcaac tggctccccc       840
     ctttgcttga ccgcattgct cggaaccgga agaccatcgt gtgcccaatg atcgatgtca       900
     tcgaccacga tgacttccgg tatgagactc aggctgggga cgccatgcgt ggtgccttcg       960
     actgggaaat gtattacaaa cggatcccaa tccctccaga actgcagaag gctgacccca      1020
     gtgacccatt tgagtctccc gtgatggctg gagggttgtt cgctgtggac cggaaatggt      1080
     tctgggagtt gggcggctac gaccctggct tggagatctg gggaggagag cagtatgaga      1140
     tctccttcaa ggtgtggatg tgtgggggcc gcatggagga catcccctgc tccagagtgg      1200
     gccacatcta caggaagtat gtgccctaca aggtccctgc cggagtcagc ctggcccgga      1260
     acctgaagcg agtggcagag gtatggatgg atgaatacgc agaatacatc taccagcgca      1320
     ggccggagta ccgccacctc tcagctggag atgtcgtggc ccagaaaaag ctccgagtct      1380
     ccctcaactg taagagcttc aagtggttta tgaccaaaat tgcctgggac ctgcccaagt      1440
     tctacccacc cgtggaaccc ccggctgcag catgggggga gattcgcaat gtgggcacag      1500
     gactgtgcac agacacgaag cttggcacac tgggctcccc actgaggctc gagacctgca      1560
     tccggggccg aggcgaggct gcttggaaca gtatgcaggt ctttaccttc acctggcggg      1620
     aggacatccg gcctggagac cctcagcaca ccaagaagtt ttgcttcgac gctgtctccc      1680
     acaccagccc agtcaccctc tacgactgcc acagcatgaa gggcaaccag ctgtggaaat      1740
     accgaaagga caagacgctg taccaccctg tgagcggcag ctgcatggac tgcagcgaga      1800
     gtgaccatag ggtcttcatg aacacctgca atccctcctc cctcacccag cagtggctct      1860
     ttgaacacac caactcgacg gtcttagaga atttcaacaa gaactgagtc cttagacctt      1920
     gacaaacccc tcaggttgct gtggagctca taaaccttcc tcctgtggga gaagaggcat      1980
     cggtgggcac caaggtgctg ggttcttgaa ggactgacat ggtggggcca cggggagaac      2040
     agaccatacc aatggctctc caagaaggcg gagcctgctc acatcatagc agagctcacc      2100
     agcctgtcag catgttccct aagtgttagg aatcgcctgg gcagccttga gccatgaggt      2160
     tgcccttgca gacaggacgg tgccctagaa aggaaggtgg tatcggcctt gggacagctt      2220
     aaacctgtgt gccagctgct ggcaaggaag tctgcctgtt cttgagggaa ctgctagaat      2280
     tgcccagctt ctgtgttggt ccagggcaat gagagtccat tgggacttcc gagtgctcca      2340
     tagctagcac tggccagcaa ccaggcgagg ggccccttcc tctgcagcca gatgtaaagg      2400
     atgtctcccc tggctctctg ggtatttcag atgcccgttc tagtttcagg gctacctggg      2460
     caccaggtcg tcagggctag ttcagccggc taagtagacc tccagaccga acagctccca      2520
     gccgacgctt ccaaagccct ttctccgtgc ttttccttgg tggctccctg ccttggagag      2580
     gaaccggtgc tgtgagggat cacctccaga gtctcctggg gggtggcttc ccccagataa      2640
     tgactgctgt ggttccaacc tcacagaacc ctggagtttc tggaaagttc tgtggttctg      2700
     ttgaaagcat agatgagcca tggcacgtgt gggcatataa cgcaagcagc caggtgtcag      2760
     gcaacccctg acccaagcag aggcggtagg gcaccagaag cttcggtcca acccaatgcc      2820
     gtcacagcca cagccgcgtg aggtgtgagg acatcacctt tagccccatg tctcaaacaa      2880
     gaactcaccc tccaaggagc tggtcacttg ccagtgaagt atctgagaca tggtcctgag      2940
     gccagaactc tgccttagag atgctgggat cggggtcatc gggtccccag gctggtcggg      3000
     ttggtgctgt agaaccacct ccacgtagcc cctgtgctgt cacagctcac ttgtggattt      3060
     ctagtgccct tttccatatg agcactctgt ctgacaagtg gccggctggg aaggagtcaa      3120
     aaaggggagt gggtgggtgt ccagaatcca gcagggatgc gtgttgcagc caaggggagt      3180
     tgagtcctca gagagcaatg cggcctcgtt tcaataaaaa ccgtgccttt tacaaagaga      3240
     aaatgcagcc gagcagctga ttccctaaac ttgaaccact tactagtgcc ttgctagaca      3300
     gacagacaga caggggagcg tggaggaggg gcacttattc aggtcctatg agcccaatga      3360
     gtgtctttac gtctgacttc aagcagaaag tgcagagcag aacctgagac ccagaggccc      3420
     ccacagcagg gacaactgcc tatttgtgcg gccctccctg agacaggaca ggctctagag      3480
     acctgacaag cccagaagtg ctctgcctga acctcactat caggggcgag ctgagcagct      3540
     gggtttccag cggatgccaa gcaggtggtt agggtggtta aggcagatgc tgccgcaagc      3600
     catccctagc ctcactcgct cccttgctcg cccgcccgat tcattccatc ctcatctggt      3660
     tctgtcccct tctccagaag tcacttcctc tgagcgaacc tcagcatttg tgactgctga      3720
     actctgacct cagagcctaa gacttgagga ggtgtgtcac aggaagaacc aggttggctt      3780
     ggtggctggc tgcagatact taatccccac cttgttttgg cttcaggtgt ggaaatcctt      3840
     gtcctgaaga gtcaggtttc tactctgctg aagggcctgt gccacagccc acgcagcagg      3900
     ccgggcggct ggcctcttcc tccaaagctt tattcagagg ctaagactac aaaaacaaga      3960
     tgtggttaga aaggcggcct cccctccgcc ccgaagattc cagaaacatt ttggaatgca      4020
     gtgtccttgc catgaggcca ttgtgtggca ggcaggctgt cttaccctgc cctgccaact      4080
     agagcttctg gctttaaaag cagccagcaa tgatagacct tgcgttgcgg cagtgagctg      4140
     ctctgatggg cggcctagtg gatctccaaa gtcagcatca cgattcccct tcagtccttc      4200
     ctgtcacgct cctccctgcg tggacccctc gcttcagcag tccctacttc tcacagagga      4260
     gactgtctgc atccagtgct cagggcagcc tgtttgtcta aagtcaggca gtgtgaaagg      4320
     aacaaagagt gcagttccac cctgaattca tcagccgctg aggctttctc cggcaaatcc      4380
     tactcatatt ttggttcaag gttttgatgc tgagccaggg ccctgctgcc accattaggt      4440
     gagagtggta gctacatccc aggtttcaag atcttaacgc gttccactca gctctgacag      4500
     ggagtccaga ggctgcaggc agggaagctg ggcactgaga cagggttccg gggatggggg      4560
     aggggcggat cccaagacca cccacctctc ctggaagaga gagccttgta aggaatgact      4620
     tatcctgttc agttgtgact gtggttgttc aataaacctc cagactttct ct              4672
//