spacer

EBI Dbfetch

ID   AK129459; SV 1; linear; mRNA; STD; MUS; 3062 BP.
XX
AC   AK129459;
XX
DT   04-OCT-2003 (Rel. 77, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus mRNA for mKIAA1869 protein.
XX
KW   FLI_CDNA.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3062
RA   Okazaki N., Kikuno R., Nagase T., Ohara O., Koga H.;
RT   ;
RL   Submitted (23-JUL-2003) to the INSDC.
RL   Hisashi Koga, Kazusa DNA Research Institute, Laboratory for Genome
RL   Informatics; 2-6-7   Kazusa-kamatari, Kisarazu, Chiba 292-0818, Japan
RL   (E-mail:mouse@kazusa.or.jp, Tel:81-438-52-3919, Fax:81-438-52-3918)
XX
RN   [2]
RX   DOI; 10.1093/dnares/10.4.167.
RX   PUBMED; 14621295.
RA   Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S.,
RA   Saga Y., Nagase T., Ohara O., Koga H.;
RT   "Prediction of the coding sequences of mouse homologues of KIAA gene: III.
RT   the complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs
RT   identified by screening of terminal sequences of cDNA clones randomly
RT   sampled from size-fractionated libraries";
RL   DNA Res. 10(4):167-180(2003).
XX
DR   MD5; ac8d42b982a2098fed260a108cd91303.
DR   Ensembl-Gn; ENSMUSG00000038777; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000090821; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168321; mus_musculus.
XX
CC   The CREATE program supported by Japan science and technology
CC   corporation; cDNA full insert sequencing: Kazusa DNA Research
CC   Institute; cDNA library construction, clone selection and 5'- &
CC   3'-end one pass sequencing.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3062
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone="mph01643"
FT                   /tissue_type="embryonic tail"
FT                   /note="vector:modified pBC SK+"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..2326
FT                   /codon_start=2
FT                   /gene="mKIAA1869"
FT                   /product="mKIAA1869 protein"
FT                   /note="CDS is predicted by in silico analysis. Start codon
FT                   is not identified."
FT                   /note="Start codon is not identified."
FT                   /db_xref="GOA:Q6ZPG8"
FT                   /db_xref="InterPro:IPR001627"
FT                   /db_xref="InterPro:IPR002165"
FT                   /db_xref="InterPro:IPR015514"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016201"
FT                   /db_xref="InterPro:IPR027231"
FT                   /db_xref="MGI:MGI:1338032"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZPG8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAC98269.1"
FT                   /translation="QQEGEELSGQARCPFDATQSTVAIFAEGSLYSATAADFQASDAVV
FT                   YRSLGPQPPLRSAKYDSKWLREPHFVYALEHGEHVYFFFREVSVEDARLGRVQFSRVAR
FT                   VCKRDMGGSPRALDRHWTSFLKLRLNCSVPGDSTFYFDVLQSLTGPVNLHGRSALFGVF
FT                   TTQTNSIPGSAVCAFYLDDIERGFEGKFKEQRSLDGAWTPVSEDKVPSPRPGSCAGVGA
FT                   AASFSSSQDLPDDVLLFIKAHPLLDPAVPPATHQPLLTLTSRALLTQVAVDGMAGPHRN
FT                   TTVLFLGSNDGTVLKVLPPGGQSLGSEPIVLEEIDAYSHARCSGKRSPRAARRIIGLEL
FT                   DTEGHRLFVAFPGCIVYLSLSRCARHGACQRSCLASLDPYCGWHRSRGCMSIRGPGGTD
FT                   VDLTGNQESTEHGDCQDGATGSQSGPGDSAYGVRRDLSPASASRSIPIPLLLACVAAAF
FT                   ALGASVSGLLVSCACRRANRRRSKDIETPGLPRPLSLRSLARLHGGGPEPPPPPKDGDA
FT                   AQTPQLYTTFLPPPDGGSPPELACLPTPETTPELPVKHLRASGGPWEWNQNGNNASEGP
FT                   GRPPRGCSGAGGPAPRVLVRPPPPGCPGQAVEVTTLEELLRYLHGPQPPRKGSEPLASA
FT                   PFTSRPPASEPGASLFVDSSPMPRDGVPPLRLDVPPEGKRAAPSGRPALSAPAPRLGVG
FT                   GSRRLPFPTHRAPPGLLTRVPSGGPARYSGGPGRHLLYLGRPEGHRGRSLKRVDVKSPL
FT                   SPKPPLASPPQPAPHGGHFNF"
XX
SQ   Sequence 3062 BP; 479 A; 1030 C; 948 G; 605 T; 0 other;
     gcaacaggag ggtgaggagc tgagtgggca ggctcgatgc ccctttgatg ccacccagtc        60
     cactgtggcc atctttgcag agggcagttt gtactcagcc acagcagcag atttccaggc       120
     cagtgatgct gtagtttaca gaagtcttgg acctcagcct ccactccgtt ctgcaaagta       180
     tgactccaag tggcttcgag agccacactt tgtctatgcg ttggagcatg gagagcacgt       240
     ctacttcttc ttccgagaag tctctgtgga ggatgcccgc ttagggaggg tgcagttttc       300
     cagggtagcc cgggtatgta aacgtgacat gggtggctca cctcgggcct tggatcgcca       360
     ctggacatcc ttccttaagc tgaggctcaa ctgctctgtc cctggggact ctaccttcta       420
     ctttgacgtc ttacagtcct taactgggcc tgtgaacctg catggccgct ccgctctctt       480
     tggggtcttc actactcaga ccaatagcat tcctgggtct gcagtctgcg ccttctacct       540
     agatgatatt gaacgtggct ttgagggcaa gttcaaggag cagaggagtc tggatggggc       600
     ctggactcct gtgtctgagg acaaggtccc ctcacccagg ccagggtcct gtgcaggtgt       660
     gggtgcagct gcctcgttct cctcctctca agacctacct gatgatgtcc tgctcttcat       720
     caaggcacac ccgctgctgg atcctgctgt gccacccgcc acccatcaac cgctcctcac       780
     tctgactagc agggccctgc tgacccaggt agctgtggac ggaatggctg gtccccacag       840
     aaatactact gtcctgtttc ttggctccaa cgatgggaca gtgctgaagg tgctacctcc       900
     agggggtcag tctttgggct ctgagcctat cgtcttggaa gagattgatg cctacagcca       960
     tgcccggtgc agtgggaagc ggtcaccccg agctgcgcgg cggatcatag ggctggagct      1020
     ggacactgag ggtcacaggc tttttgtggc ctttcctgga tgtatcgtct acctctctct      1080
     cagccggtgt gcccggcatg gagcatgtca gaggagctgc ctggcttctc tggacccata      1140
     ctgtggatgg catcgatcca gaggctgcat gagtatcagg ggacctggtg ggactgatgt      1200
     cgatctgact gggaaccagg aatccacaga gcacggtgac tgccaagatg gagcgaccgg      1260
     gagtcagtct ggccctggag attctgctta tggcgtgcgc agggaccttt ccccagcctc      1320
     agcctcccga tccattccca tcccactcct cctggcctgt gtggccgcgg ccttcgcttt      1380
     gggcgcctca gtctccggtc tcttggtgtc ctgtgcttgt cgtcgcgcga accgccgtcg      1440
     gagcaaggac atcgagaccc cggggctgcc gcgccccctc tcccttcgca gcctggcccg      1500
     gctgcacggt ggcggtcctg agcccccgcc tccgcccaag gatggagatg cagcgcaaac      1560
     gccccagctc tacactacct tcctgcctcc gcccgacggc ggatccccac cggagctggc      1620
     ctgcctaccc acgccggaga cgacgcccga gctgcccgtg aagcacctcc gtgcctccgg      1680
     gggcccctgg gaatggaacc agaatgggaa caacgcctcg gagggcccag gccgcccacc      1740
     acggggctgc agcggggcgg gcgggcccgc accgcgagtg ctggtgaggc caccgccccc      1800
     tggctgcccc gggcaggcgg tagaggtgac cacgctggag gaactgctgc gctacctgca      1860
     cggccctcag ccgcccagga agggtagcga acctctcgcc tccgccccgt tcacctcccg      1920
     gccgcccgcc tcggagcccg gcgcctcgct gttcgtggac tccagcccga tgccgcggga      1980
     tggcgttccg ccgctcaggc tcgacgtgcc acccgaaggc aagcgcgctg ccccgagcgg      2040
     gcggcctgct ctctcggccc cagccccgcg cctgggtgtc ggcggcagcc gccgattgcc      2100
     ctttcccaca caccgggcgc ccccgggcct gctcacgcga gtgccctcgg gaggcccggc      2160
     caggtactcc ggggggcccg ggaggcacct cctgtacctg ggccggcccg aaggccatcg      2220
     cggccgctcc ctgaagaggg tggacgtgaa gtctccgctg tcgcccaagc cgcccctcgc      2280
     ctccccgccg cagcccgccc cgcacggtgg tcatttcaac ttctgacgga agctgctcgc      2340
     gcccgcccgt cgaggcgctg gaggccgctg gccttcccgg actccgagac tctcccgggg      2400
     ccccccctct cgcctcggtt tatttattga cttgtctttc ccctgtcctt tggcgaggaa      2460
     ctcgcccctc ggagcgccag catttcaggg gacctggccg actcccactc cccgctccct      2520
     tccagccacg ctgccttaag tcgccgctcc ggactcccgc ggactgagcc ccgggcgggc      2580
     cggccggggc tggagccgcg cgctgtgtag agtcctcggg cctcccgggg ccgggacgtg      2640
     cctcctccta ctgtgtagga gccccctgct tcccaataca gccgtgtccc caagccgctg      2700
     cctgactttc ctcgcggtgc gggaggggaa ggagggcgcg gcgcccggcc ctctgggtaa      2760
     ccgtgctcct gaaagtcggc ctccactgca gctcggcccc caagtctctc cggagcaatt      2820
     ggcttggcgg gtgtcccacc ggggttaatc aggaaaggtt tcctgaagga ggcaatcaaa      2880
     gacctggtgt gtgtgggctg agccggggcc caggagagca gtgggtactg attgggggtg      2940
     ccggggaagg cgctcagcac gtttctggat agaggtcagg cacctttcca cggcctacac      3000
     tctggggtgg gagagggaac ttttggagaa ataaaacgaa gctgctgcgt gatttgaatt      3060
     tc                                                                     3062
//


spacer
spacer