Dbfetch

ID   AK129339; SV 1; linear; mRNA; STD; MUS; 2608 BP.
XX
AC   AK129339;
XX
DT   04-OCT-2003 (Rel. 77, Created)
DT   21-NOV-2003 (Rel. 77, Last updated, Version 2)
XX
DE   Mus musculus mRNA for mKIAA1374 protein.
XX
KW   FLI_CDNA.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2608
RA   Okazaki N., Kikuno R., Nagase T., Ohara O., Koga H.;
RT   ;
RL   Submitted (23-JUL-2003) to the INSDC.
RL   Hisashi Koga, Kazusa DNA Research Institute, Laboratory for Genome
RL   Informatics; 2-6-7   Kazusa-kamatari, Kisarazu, Chiba 292-0818, Japan
RL   (E-mail:mouse@kazusa.or.jp, Tel:81-438-52-3919, Fax:81-438-52-3918)
XX
RN   [2]
RX   DOI; 10.1093/dnares/10.4.167.
RX   PUBMED; 14621295.
RA   Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S.,
RA   Saga Y., Nagase T., Ohara O., Koga H.;
RT   "Prediction of the coding sequences of mouse homologues of KIAA gene: III.
RT   the complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs
RT   identified by screening of terminal sequences of cDNA clones randomly
RT   sampled from size-fractionated libraries";
RL   DNA Res. 10(4):167-180(2003).
XX
DR   MD5; db124bd9de1935286a6c088c1a48530c.
DR   Ensembl-Gn; ENSMUSG00000027778; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029347; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107812; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169064; mus_musculus.
XX
CC   The CREATE program supported by Japan science and technology
CC   corporation; cDNA full insert sequencing: Kazusa DNA Research
CC   Institute; cDNA library construction, clone selection and 5'- &
CC   3'-end one pass sequencing.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2608
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone="mpj01605"
FT                   /tissue_type="embryonic tail"
FT                   /note="vector:modified pBC SK+"
FT                   /db_xref="taxon:10090"
FT   CDS             <92..1432
FT                   /codon_start=1
FT                   /gene="mKIAA1374"
FT                   /product="mKIAA1374 protein"
FT                   /note="CDS is predicted by in silico analysis. Start codon
FT                   is not identified."
FT                   /db_xref="GOA:Q8K057"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="MGI:MGI:1915509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8K057"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAC98149.1"
FT                   /translation="HFSGTGDMRLKISLSKEPKHQELVSCVGWTTAEELYSCSDDHQIV
FT                   KWNLLTSETSLIVKLPDDIYPIDLHWFPKSLGIKKQTQAESFVLTSSDGKFHLISKLGR
FT                   VEKSVEAHCGAVLAGRWNYEGTALVTVGEDGQVKIWSKTGMLRSTLAQQGTPVYSVAWG
FT                   PDSEKVLYTAGKQLIIKPLQPNAKVLQWKAHDGIILKVDWNSVNDLILSAGEDCKYKVW
FT                   DSYGRVLYGSQPHEHPITSVAWAPDGELFAVGSFHTLRLCDKTGWSYALEKPNTGSIFN
FT                   IAWSIDGTQIAGACGNGHVVFAHVVEQRWEWKNFQVTLTKRRTMQVRNVLNDAVDLLEF
FT                   RDRVIKASLNHAHLVVSTSLQCYVFSTKNWNTPLIFDLKEGTVSLILQAERHFLLVDGG
FT                   GIYLHSYEGRFISSPKFPGMRTDILNAQTVSLSNDTIAIKDKADEKK"
XX
SQ   Sequence 2608 BP; 771 A; 507 C; 575 G; 755 T; 0 other;
     tcgggaggct atttggtaac tagttcgagc tctgagagca gtcgccaccg ctttcctgga        60
     acttgagtga atacaatcaa gcggtattta acatttctct ggaactggag acatgagact       120
     gaagatatct ctctcaaagg aaccaaagca tcaagaatta gtgagctgtg tgggttggac       180
     tacggcggag gagctgtact catgcagtga cgaccaccag atcgtcaagt ggaacctgct       240
     aaccagtgaa accagcctaa tagtcaagct gcctgatgac atctacccga tagaccttca       300
     ctggtttcca aagagtttag gcataaagaa acagacgcag gcagaaagct tcgtcctcac       360
     aagctctgat ggtaagtttc atctgatttc caagttagga agagtggaaa agagtgtaga       420
     agctcactgt ggggctgtgc tcgcaggacg atggaattat gaggggactg cattagtgac       480
     agttggagaa gatggacaag tgaaaatctg gtcaaagaca gggatgctca gatcaacttt       540
     agcccagcaa ggaacaccag tgtactcagt agcctggggc cctgattcag aaaaggttct       600
     ttatacagca ggcaaacagc tcatcattaa acctcttcaa ccaaatgcta aagttttaca       660
     gtggaaagcc catgatggca tcattttaaa agtcgactgg aactcagtga atgaccttat       720
     tttatctgcg ggtgaagact gtaagtataa ggtttgggat agttatggcc gcgtgctgta       780
     cggctcccag cctcatgagc accccatcac ctcagtggcc tgggctccag atggggagtt       840
     atttgccgtt ggatcgtttc atacgttacg cttgtgtgat aaaactgggt ggtcatatgc       900
     tttagagaaa cccaacactg gcagcatatt taacattgcg tggtctattg atggcactca       960
     gatcgcggga gcctgtggga acgggcatgt tgtctttgca catgtggtgg agcagcgctg      1020
     ggagtggaaa aattttcaag taacgctaac gaagagaagg accatgcagg ttcgcaacgt      1080
     tctcaatgat gccgtggatc tcctggagtt ccgggacaga gtcattaaag catccttaaa      1140
     ccacgcacac ttggtggtct ccacgtccct gcagtgctac gtgttctcta cgaagaactg      1200
     gaatacacca cttatatttg atctcaaaga aggaactgtt agtttaattc tgcaggcaga      1260
     aagacatttt cttctggtgg atggcggggg tatctacctg cactcttatg aagggcgctt      1320
     catttcttct ccaaagtttc ctggcatgag aacagacatc ctgaacgctc agactgtgtc      1380
     tctgagcaat gacacgatag caataaagga caaagctgac gagaagaaat gaaatctcag      1440
     aaattgctct ggatcaaaaa ggacttacca atgacagaaa aattgctttc attgacaaga      1500
     acagagatct ctacatcacc tctgtgaaac gatttgggaa agaagaacag attattaaac      1560
     ttggtataat aatttccatg tacttaaatt tgtaattatt gtctgttttc ttagatggtc      1620
     tgctgtgtac ctagcagctt taatgtctta atgagtgaat gagttttagt ctcacatttc      1680
     ttcacaactt tgtcactcaa tttcagtagc aaatttgaat tctgtagcta agtcagcact      1740
     gaaacacctg ctgattaaac ccagaatggc tctagggaga acattcaagt attttcattt      1800
     ttcatagttt ttacatctgt acacttgtta tacgaacaga aagtagagat atagccattg      1860
     tattaattag gatcttgttt gtcagctcat tttaaagata gattttaata tctgttgata      1920
     ctaatggacc acaactatta tttttaagga accatggtac atactttggc atggtgtgat      1980
     acatgcaata tcctctgtgg aattcaagat actcgattca cagtatggta ttaccctaat      2040
     accatttatg tggacagaga cattctgcct aaaacattgt acgaaagaga tgcaaggtaa      2100
     tgtcctgcac cggattccat gttataaata aagctctaat tgtcctgctt tttcatggat      2160
     gtttttaaaa gtttaatcag acacaactac attgctcagc taaagctggt taagatttaa      2220
     gtaatggact caaattgaaa acaaaatatg aactatttac tcatctttta caaatgacta      2280
     taatttctta ggtctgttta atgatagctc agttgaggtt ttttcactgt gatttagtga      2340
     tttttttaac ctggcagcat taagattttg cagcaagata tactttgtga cagctaccca      2400
     gcatacacat tttcatttac tttaagaatc ccaatggggt tggggagatg gctcagtggt      2460
     taagaacatt gattgctctt tcagaggtcc tgagttcaat tcccagcaac cagatagtgg      2520
     gtcacaacca tctgtaatag gatcctatgc cctcttctgt tgtgtctgaa gacagctaca      2580
     gggtactcat ataaataaaa taaatctt                                         2608
//