Dbfetch

ID   AK129326; SV 1; linear; mRNA; STD; MUS; 3047 BP.
XX
AC   AK129326;
XX
DT   04-OCT-2003 (Rel. 77, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus mRNA for mKIAA1303 protein.
XX
KW   FLI_CDNA.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3047
RA   Okazaki N., Kikuno R., Nagase T., Ohara O., Koga H.;
RT   ;
RL   Submitted (23-JUL-2003) to the INSDC.
RL   Hisashi Koga, Kazusa DNA Research Institute, Laboratory for Genome
RL   Informatics; 2-6-7   Kazusa-kamatari, Kisarazu, Chiba 292-0818, Japan
RL   (E-mail:mouse@kazusa.or.jp, Tel:81-438-52-3919, Fax:81-438-52-3918)
XX
RN   [2]
RX   DOI; 10.1093/dnares/10.4.167.
RX   PUBMED; 14621295.
RA   Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S.,
RA   Saga Y., Nagase T., Ohara O., Koga H.;
RT   "Prediction of the coding sequences of mouse homologues of KIAA gene: III.
RT   the complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs
RT   identified by screening of terminal sequences of cDNA clones randomly
RT   sampled from size-fractionated libraries";
RL   DNA Res. 10(4):167-180(2003).
XX
DR   MD5; f3e9cb80aeec81113be4457f8b9e8238.
XX
CC   The CREATE program supported by Japan science and technology
CC   corporation; cDNA full insert sequencing: Kazusa DNA Research
CC   Institute; cDNA library construction, clone selection and 5'- &
CC   3'-end one pass sequencing.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3047
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone="mph02336"
FT                   /tissue_type="embryonic tail"
FT                   /note="vector:modified pBC SK+"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..1123
FT                   /codon_start=2
FT                   /gene="mKIAA1303"
FT                   /product="mKIAA1303 protein"
FT                   /note="CDS is predicted by in silico analysis. Start codon
FT                   is not identified."
FT                   /note="Start codon is not identified."
FT                   /db_xref="GOA:Q6ZPU3"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR004083"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="MGI:MGI:1921620"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZPU3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAC98136.1"
FT                   /translation="SARYFAQPVMKIPEEHDLESQIRKEREWRFLRNTRVRKQAQQVIQ
FT                   KGITRLDDQIFLNRNPGVPSVVKFHPFTPCIAVADKDSICFWDWEKGEKLDYFHNGNPR
FT                   YTRVTAMEYLNGQDCSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGA
FT                   GMVVDWEQETGLLMSSGDVRIVRIWDTDRETKVQDIPTGADSCVTSLSCDSHRSLIVAG
FT                   LGDGSIRVYDRRMALSECRVMTYREHTAWVVKAYLQKHPEGHIVSVSVNGDVRFFDPRM
FT                   PESVNVMQIVKGLTALDIHPQANLIACGSMNQFTAIYNGNGELINNIKYYDGFMGQRVG
FT                   AISCLAFHPHWPHLAVGSNDYYISVYSVEKRVR"
XX
SQ   Sequence 3047 BP; 706 A; 813 C; 877 G; 651 T; 0 other;
     gagtgcccgc tactttgccc agccagtcat gaagatcccc gaggagcatg acctagagag        60
     tcagatccgc aaggagcgtg agtggcggtt cctgaggaac actcgagtca ggaagcaggc       120
     tcagcaggtc atccagaagg gcatcaccag actggacgat cagatctttc tgaacaggaa       180
     ccccggcgtt ccttctgtgg tcaaattcca tccctttaca ccatgcatag ctgtcgccga       240
     caaggacagc atctgttttt gggactggga gaaaggagag aagctggact atttccacaa       300
     tggcaaccct cggtacacca gggtcaccgc catggagtac ctgaatggtc aggactgttc       360
     cttgctgctg acagccacag atgatggtgc catcagggtc tggaagaatt ttgctgattt       420
     ggaaaagaat ccagagatgg tgactgcgtg gcaagggctc tcagacatgc ttccaacaac       480
     acgaggagct gggatggtgg tagactggga acaagaaact ggccttctca tgagctcagg       540
     ggacgtgcgc attgtcagga tctgggatac tgaccgggag acgaaggtgc aggacatccc       600
     cacgggtgct gacagctgtg tgacaagtct gtcttgtgat tcgcaccgtt cgctcattgt       660
     ggctggcctg ggtgatggct cgatccgtgt ctacgacagg aggatggcac tcagtgaatg       720
     ccgggtcatg acttaccgag agcacacagc gtgggtggta aaggcctacc tgcagaagca       780
     ccctgagggc cacatcgtga gtgtgagtgt caatggagat gtgcgcttct tcgaccctcg       840
     gatgcccgag tctgtgaatg taatgcagat tgtgaagggg ctgacagccc tggacatcca       900
     cccccaggca aacctgatcg cctgtggctc catgaaccag ttcacagcca tctacaacgg       960
     aaatggagag ctgatcaaca acatcaaata ctatgatggc ttcatgggcc agcgagtcgg      1020
     ggccatcagc tgcctggctt tccacccaca ctggcctcat ctggccgtag gaagcaatga      1080
     ctactacatt tccgtgtatt cggtggagaa gcgtgtcaga tagcggcacc taggaccact      1140
     gccaggccgc agccacctct gctgtacata gtgagccagc ctgcactgct cggatgcagt      1200
     gcccacctac ccacccacct gcaaaccccg gctcctgact tggccgtggc cagctgagga      1260
     ggggcttgca catccttcct tctgtcttca ctataacagc gtacaggtcc agagcagggg      1320
     aggggttggc ctggcttccc atcaagaacc agcacccagg caccaaggac ctcctcagtg      1380
     cagcatggtc ctttcctgcc ctgttttctt ctgaggtttt acaaagggac acatttgatt      1440
     tttccatgtg atcaaagcat tagttacaga gcagacagcg ccctgtagaa tagccgtgct      1500
     ggggctccta agggccatgg cccagcccca ctgtcctctc agagtgtgct gccagtcctg      1560
     ggaaatggat aagagcaatt gggggaagag agagggtaga agagagggaa ggcctctcct      1620
     gctacaaggt atggaagtct gagcctggcc ctcctggagc accgaggcag tccagcacat      1680
     tgtgtatgtc atggtgctat gaggaaagct agacctctga ggtccagcct ggcgggcgcc      1740
     ctcaagtgag ctagctgcag gagagggtct ggttcagggc agatgaggca gatctgtagt      1800
     tagcggctgc ctccatctat caggcatatt ctgaagtgct tctctcccat agggcagtaa      1860
     cagtggccac aggcctgtct cctgcttgtg ccacacacag gtacacacgc atgcaggcac      1920
     gcagcctccc catccataat tacatggatg ccctggtctt cctgcccatg tacacttagg      1980
     tgtgcattca tgcaggccca tagtttcccc tcctgcacat atatgggcac tgtggccggc      2040
     cacatgcacg cacatgctgg cctcaccatg catagggctc agacacttca ctgaactcag      2100
     aggctggagg gcagcatcag ctctgttgat ggtggaactg aggttacatg atgcagtatg      2160
     tgctgagcac gagttccaca gtgtcctggt gtgcctgaca cgtgtctgcg tgcacaggca      2220
     agagaggacc atggacactg tagccctaga tgtcagcact gtccccgtgt gtccgacatg      2280
     tgtctgtgtg cacaggcaag tgaggacctt aggcactgca gccctggatg gacccagcat      2340
     tgcagagcag ttgcacacaa acaggacaca acacaatgat gttttgaaaa gcattttccg      2400
     ttttccctgg gaatcaggat ctttcagagg acaagtgcca acaggagccc agggacacgg      2460
     gttgggacat ctgtggcaga ggctgggtcc ctgtgctgtg ttcagtggac ctgttttagc      2520
     caagagcatc ttccctgtga gaggatccta caggctgagc tgtcctgggc aagcagaaca      2580
     ggagaccctg gcacggcccc tggaaatgca ttctcccaac cgggtggggc tcaaggaagc      2640
     cagccccttg gttgggccat agagcagtgt ggcgacagga aggccctaga gccacctgac      2700
     ttacccctgc tcagttctgc agagagcttc aggggctgag tgtgcgtcag ctcagtcctt      2760
     gtccaactgg tgactcagtt ttggccgcac agggccgcct gatgggctgg gctgcttccc      2820
     tgccctggtg gaaccagtgt ttgcatcttg cccacaggct gggcctcaca agtctgatgc      2880
     ggaaattcaa tcatgaagct aagcaaagct cgagagagcg ctgacctaga gcgcatttct      2940
     ctatttattt taccaaaatg agagttgaaa ggactgacag gacacggaac tgcagtggcg      3000
     tccagagcag tgacagcaac agagtgttaa taaagaataa agccgtg                    3047
//