Dbfetch

ID   AK129116; SV 1; linear; mRNA; STD; MUS; 3737 BP.
XX
AC   AK129116;
XX
DT   04-OCT-2003 (Rel. 77, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus mRNA for mKIAA0331 protein.
XX
KW   FLI_CDNA.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3737
RA   Okazaki N., Kikuno R., Nagase T., Ohara O., Koga H.;
RT   ;
RL   Submitted (23-JUL-2003) to the INSDC.
RL   Hisashi Koga, Kazusa DNA Research Institute, Laboratory for Genome
RL   Informatics; 2-6-7   Kazusa-kamatari, Kisarazu, Chiba 292-0818, Japan
RL   (E-mail:mouse@kazusa.or.jp, Tel:81-438-52-3919, Fax:81-438-52-3918)
XX
RN   [2]
RX   DOI; 10.1093/dnares/10.4.167.
RX   PUBMED; 14621295.
RA   Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S.,
RA   Saga Y., Nagase T., Ohara O., Koga H.;
RT   "Prediction of the coding sequences of mouse homologues of KIAA gene: III.
RT   the complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs
RT   identified by screening of terminal sequences of cDNA clones randomly
RT   sampled from size-fractionated libraries";
RL   DNA Res. 10(4):167-180(2003).
XX
DR   MD5; 0ef012286c79438fe596015fc3b57706.
XX
CC   The CREATE program supported by Japan science and technology
CC   corporation; cDNA full insert sequencing: Kazusa DNA Research
CC   Institute; cDNA library construction, clone selection and 5'- &
CC   3'-end one pass sequencing.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3737
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone="mph02015"
FT                   /tissue_type="embryonic tail"
FT                   /note="vector:modified pBC SK+"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..1727
FT                   /codon_start=3
FT                   /gene="mKIAA0331"
FT                   /product="mKIAA0331 protein"
FT                   /note="CDS is predicted by in silico analysis. Start codon
FT                   is not identified."
FT                   /note="Start codon is not identified."
FT                   /db_xref="InterPro:IPR001627"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013151"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015513"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016201"
FT                   /db_xref="InterPro:IPR027231"
FT                   /db_xref="MGI:MGI:1340034"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZQD8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAC97926.1"
FT                   /translation="IFRSMGKLGHIRTEHDDERLLKEPKFVGSYMIPDNEDRDDNKMYF
FT                   FFTEKALEAENNAHTIYTRVGRLCVNDMGGQRILVNKWSTFLKARLVCSVPGMNGIDTY
FT                   FDELEDVFLLPTRDPKNPVIFGLFNTTSNIFRGHAVCVYHMSSIREAFNGPYAHKEGPE
FT                   YHWSLYEGKVPYPRPGSCASKVNGGKYGTTKDYPDDAIRFARMHPLMYQPIKPVHKKPI
FT                   LVKTDGKYNLRQLAVDRVEAEDGQYDVLFIGTDTGIVLKVITIYNQETEWMEEVILEEL
FT                   QIFKDPAPIISMEISSKRQQLYIGSASAVAQVRFHHCDMYGSACADCCLARDPYCAWDG
FT                   ISCSRYYPTGAHAKRRFRRQDVRHGNAAQQCFGQQFVGDALDRTEERLAYGIESNSTLL
FT                   ECTPRSLQAKVIWFVQKGRDVRKEEVKTDDRVVKMDLGLLFLRVRKSDAGTYFCQTVEH
FT                   NFVHTVRKITLEVVEEHKVEGMFHKDHEEERHHKMPCPPLSGMSQGTKPWYKEFLQLIG
FT                   YSNFQRVEEYCEKVWCTDKKRKKLKMSPSKWKYANPQEKRLRSKAEHFRLPRHTLLS"
XX
SQ   Sequence 3737 BP; 1160 A; 702 C; 800 G; 1075 T; 0 other;
     cgatcttccg cagcatgggg aagttaggcc atattcgcac tgagcatgac gatgagcggc        60
     tcctgaaaga accaaaattt gtaggttcat atatgattcc tgataacgaa gaccgagatg       120
     acaacaaaat gtactttttc tttactgaga aggcgctgga ggcggagaac aacgcccaca       180
     cgatctacac ccgagtgggg cggctgtgcg tgaatgacat gggaggacag agaatcctgg       240
     tgaacaagtg gagcactttc cttaaagcgc ggctggtttg ctcagtgccg ggaatgaatg       300
     gaatcgacac atactttgac gaactagagg atgtgttttt actgccgacc agagatccta       360
     agaatccagt gatatttgga ctgtttaata ctaccagcaa tatatttaga ggccatgctg       420
     tatgtgtgta tcacatgtca agtatccggg aagcctttaa tggcccatat gctcataaag       480
     aaggccctga ataccactgg tcactatatg aaggaaaagt cccctaccca aggcctggtt       540
     cctgtgccag caaagtaaac ggaggcaagt atggaaccac caaagattac cccgatgacg       600
     ccatccggtt cgcaaggatg catcctctaa tgtatcagcc cataaaacct gttcataaaa       660
     aaccaatact ggtaaaaaca gatggaaaat acaacctgag gcaacttgcc gtggatcggg       720
     tggaagcgga ggatggccag tatgacgtct tatttattgg gacagacaca ggaattgtgc       780
     tgaaagtaat cacaatttac aaccaagaaa cagagtggat ggaggaagtc attctagagg       840
     aacttcaaat attcaaggat ccagccccta tcatttctat ggaaatttct tcaaagagac       900
     aacagcttta cattggatca gcctctgctg tggcacaagt cagattccat cactgcgaca       960
     tgtatggcag tgcttgtgct gactgctgcc tggctcgaga cccgtactgt gcctgggatg      1020
     gcatatcctg ctccaggtac tacccaacag gtgcacacgc aaagaggagg ttccgcaggc      1080
     aggacgttcg gcatggcaac gccgcccaac agtgctttgg acagcaattt gttggagacg      1140
     cgttggacag gactgaagag aggctggctt atggcataga gagcaacagt actctgttgg      1200
     aatgcacccc gcgatcacta caagcaaaag tcatctggtt tgtacagaag ggacgcgacg      1260
     taagaaaaga agaggtgaag acggatgaca gagttgtcaa gatggacttg ggcttgctct      1320
     tcctcagagt acgcaagtca gatgcaggga cctatttttg ccagacagta gaacacaatt      1380
     ttgtccatac tgtgcgtaaa atcaccttgg aggtggtcga agagcataaa gtggagggca      1440
     tgtttcataa ggaccatgaa gaggaaagac atcacaagat gccctgccct cccttaagcg      1500
     gtatgtctca ggggacaaaa ccgtggtaca aggaattctt gcagctgatt ggctacagca      1560
     acttccagag agtggaagaa tactgcgaaa aggtgtggtg tacagataag aagaggaaaa      1620
     agcttaaaat gtctccctcc aagtggaagt atgccaaccc ccaggaaaag aggcttcgct      1680
     ctaaagctga gcacttccgc ctgcccaggc acacgctgct ctcctgaggg cgccctctgc      1740
     cggcggctga ggaacctagg atggaaacat ttttttaaag ggggggaaaa aaaaaagact      1800
     gaaagcatgc agtctctttc cattacttca aagaactttc tgtagtactg agaggctggg      1860
     aaggtgtttt aagttattct gcatattcat ctgactgtac aaacatctct ctcacagtac      1920
     tagtacttaa acgagtgtat tgctttaaaa ggcttcacgt atttatcaac atatgatcgg      1980
     gctgtaattt tgagcttgct tttcagggaa attattttgc cattgggata tgtattataa      2040
     ttataatatt aaagaaaaag ttataggttt tcataatcaa gaaaaatgta aaactctttc      2100
     tggagttttt tcttttttct tttcctcttt gcagccataa ggtaaaatat acagaatatc      2160
     agatattgta gaattatcgt gtgagctttc tggtcagttg ttgatttttt tttttaagcc      2220
     ataagttgta tgtagctgtg ttgtggttgc tataaactgt acaagaaatc tgcaacccat      2280
     ccattctgag gcttgttctc ttcatgaaac actcactaaa ctatattaag aatatttctg      2340
     ttttataaac aagacatatc ttttaaattt cacttcagtg tggaaggatg gaagatagcc      2400
     tctcagaaag atatttttaa atagtttcaa accatgaaag tagaattctg ttaaaaaggt      2460
     ctgtgcttcc ctcttgtggt acaagaaggc attgcatctc tcaatgctgt ttccataatt      2520
     ttcctgcaat gacttgaaaa caaaatgtag tagatacatc tagttcacta ttcagaagac      2580
     tcaattaaaa aataatttta tataataatt taatatggaa atagcatgct tctggttaat      2640
     tcattacttc acaacacaac gaagatgtta actgcatttg agctttgaaa tagaagaaag      2700
     tacctttcca gtcctaccct gagacaagac actctgaaag tgtgctttac ccgcaaagaa      2760
     attatcaaag cattctttct cagaaatgaa atcttcctat tttatattta cttcttggat      2820
     tcgttttact actgacatct ttagagaatc attatctttg tcttatgaat ataatcaaaa      2880
     tttatatttt tcagaatgtt tatttcttga gatttttctt ctctgtattt taaagagtta      2940
     gcagcttccg ttctaaaata tgatttttat gaggcttttc agttcggtaa gagtaacgca      3000
     agtggattgt aataagaaca attatgaata cgtattcaga cttaaattta actattatgt      3060
     cagctatctc agtatgctat ataattaaga atataaagtg ttgagaactt ctaatggatt      3120
     tctttttctg tctaaaatta gtgactacat aaatattcca caattttgaa attttaaaat      3180
     tttggaaatt ttaaagtcca gaatttctaa aacatataac tagtatgaat aaagagaatg      3240
     ttgacatcct ctgaaagtcc acacgttatt gactgtagaa tccactgtgt gccattgttc      3300
     tccagcaata gtagttggca aaagggagta ttcaaaactt ttaaaatact gtagtttatg      3360
     aacacaaagg ggggagggaa aattggggaa ttaaaaccaa aaccacatca ctagttccta      3420
     aggaaaggat atgtctgcaa tattacaaga gagcagaaaa atctatggag aagttttttt      3480
     tgttgttgtt ttgtttttgt ttttttgaga cagggtttct ctgtatagtc ctagctgtcc      3540
     tggaattcac tctgtagacc aggctggcct cgaactcaga aattcacctg cctctgcctc      3600
     ccaagtgttg ggactaaagg tgtgtgccac cacgcctggc aggagaggtt ttcaaatggc      3660
     ccttccactt agcaaattac aggtaagggg agagttttat cttaacaaat aacataaaat      3720
     aaaaacaaat taaagtt                                                     3737
//