spacer

EBI Dbfetch

ID   AK122415; SV 2; linear; mRNA; STD; MUS; 3579 BP.
XX
AC   AK122415;
XX
DT   15-MAR-2003 (Rel. 75, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus mRNA for mKIAA0991 protein.
XX
KW   FLI_CDNA.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3579
RA   Okazaki N., Kikuno R., Nagase T., Ohara O., Koga H.;
RT   ;
RL   Submitted (07-FEB-2003) to the INSDC.
RL   Hisashi Koga, Kazusa DNA Research Institute, Laboratory for Genome
RL   Informatics; 2-6-7   Kazusa-kamatari, Kisarazu, Chiba 292-0818, Japan
RL   (E-mail:mouse@kazusa.or.jp, Tel:81-438-52-3919, Fax:81-438-52-3918)
XX
RN   [2]
RX   DOI; 10.1093/dnares/10.1.35.
RX   PUBMED; 12693553.
RA   Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S.,
RA   Nakajima D., Nagase T., Ohara O., Koga H.;
RT   "Prediction of the coding sequences of mouse homologues of KIAA gene: II.
RT   The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs
RT   identified by screening of terminal sequences of cDNA clones randomly
RT   sampled from size-fractionated libraries";
RL   DNA Res. 10(1):35-48(2003).
XX
DR   MD5; 6e63de03a5f49f882ef5d2655afb7b7e.
DR   Ensembl-Gn; ENSMUSG00000059248; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019038; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093907; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100193; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106349; mus_musculus.
XX
CC   The CREATE program supported by Japan science and technology
CC   corporation; cDNA full insert sequencing: Kazusa DNA Research
CC   Institute; cDNA library construction, clone selection and 5'- &
CC   3'-end one pass sequencing.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3579
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone="mph02064"
FT                   /tissue_type="embryonic tail"
FT                   /note="vector:modified pBC SK+"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..1820
FT                   /codon_start=3
FT                   /gene="mKIAA0991"
FT                   /product="mKIAA0991 protein"
FT                   /note="CDS is predicted by in silico analysis. Start codon
FT                   is not identified."
FT                   /db_xref="GOA:Q80UG5"
FT                   /db_xref="InterPro:IPR000038"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1858222"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q80UG5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAC65697.2"
FT                   /translation="AEGLRRPALHRERERAGPGLRGTPCAPATMSDPAVNAQLDGIISD
FT                   FEALKRSFEVEEIEPPNSTPPRRVQTPLLRATVASSSQKFQDLGVKNSEPAARLVDSLS
FT                   QRSPKPSLRRVELAGAKAPEPMSRRTEISIDISSKQVESTASAAGPSRFGLKRAEVLGH
FT                   KTPEPVPRRTEITIVKPQESVLRRVETPASKIPEGSAVPATDAAPKRVEIQVPKPAEAP
FT                   NCPLPSQTLENSEAPMSQLQSRLEPRPSVAEVPYRNQEDSEVTPSCVGDMADNPRDAML
FT                   KQAPASRNEKAPMEFGYVGIDSILEQMRRKAMKQGFEFNIMVVGQSGLGKSTLINTLFK
FT                   SKISRKSVQPTSEERIPKTIEIKSITHDIEEKGVRMKLTVIDTPGFGDHINNENCWQPI
FT                   MKFINDQYEKYLQEEVNINRKKRIPDTRVHCCLYFIPATGHSLRPLDIEFMKRLSKVVN
FT                   IVPVIAKADTLTLEERVYFKQRITADLLSNGIDVYPQKEFDEDAEDRLVNEKFREMIPF
FT                   AVVGSDHEYQVNGKRILGRKTKWGTIEVENTTHCEFAYLRDLLIRTHMQNIKDITSNIH
FT                   FEAYRVKRLNEGNSAMANGIEKEPEAQEM"
XX
SQ   Sequence 3579 BP; 826 A; 1058 C; 980 G; 715 T; 0 other;
     gggccgaggg gctccggcgg ccagctctgc accgggagcg ggagcgcgca gggcccggtc        60
     tccgcgggac tccctgcgca ccagccacca tgtccgaccc cgcggtcaac gcacagctgg       120
     acgggatcat ttcagacttt gaagccttaa agagatcgtt tgaagtcgag gagattgagc       180
     cgcccaactc cacgccaccc cggagggtcc agacccctct gctccgcgcc acggtggcca       240
     gctccagcca gaaattccag gacctggggg tgaagaactc agagcccgct gcccgccttg       300
     tagactccct gagccagcgc tcccccaagc cttccctgcg gagggtggag ctggcgggag       360
     ccaaggcgcc tgagcccatg tctcgacgca cagagatctc catcgacatc tcctccaagc       420
     aggtggagag cacggcctcc gctgccgggc cctcacggtt cggccttaag agggctgaag       480
     tcctgggcca caagacccca gagcctgtcc ctcggaggac ggagatcacc attgtcaagc       540
     ctcaggagtc agtgctccgc agggtggaga cccctgcctc caagattccc gagggctctg       600
     ccgtgcctgc cacagatgca gcccccaaga gggtagagat ccaggtgccc aagccagctg       660
     aggcacccaa ctgtccgctc ccgtcccaga ccctggagaa ctccgaggcc ccgatgtctc       720
     aactgcagag caggctggag cccaggcctt ccgtggctga ggtcccatat cggaaccagg       780
     aagactccga ggtgactccc agctgtgttg gcgacatggc tgacaaccct agagatgcca       840
     tgctcaagca ggcccccgcg tcacggaacg aaaaggcccc catggagttc ggctatgtgg       900
     ggatcgactc catcctggag cagatgcgca ggaaggctat gaaacagggc ttcgagttta       960
     acatcatggt ggttgggcag agcggcctcg ggaagtccac tttaatcaat accctcttca      1020
     agtccaaaat cagccggaag tcggtgcagc ccacctcgga ggaacgcatc cccaagacga      1080
     tcgaaatcaa gtcgatcacc cacgatattg aagagaaggg ggttcgaatg aagctgacag      1140
     tgattgacac gccgggcttc ggagaccaca tcaacaatga gaactgctgg cagcccatta      1200
     tgaagttcat caatgaccaa tatgagaagt acctgcagga ggaagtcaac atcaaccgga      1260
     agaagcgcat tcccgacacc cgtgtccact gctgcctcta cttcatccca gccaccggcc      1320
     actcgctcag gcccctggac attgaattca tgaagcgcct aagcaaagtg gtgaacattg      1380
     tcccagtcat cgccaaggct gacacgctga ccctggagga gagggtctac ttcaaacagc      1440
     ggatcactgc agacctgctg tccaacggca ttgacgtgta cccgcagaag gagtttgatg      1500
     aggacgcaga agaccggctg gtgaacgaaa agttccggga gatgatccca tttgctgtgg      1560
     tgggcagcga ccatgagtat caagtcaatg gcaagaggat tctgggaagg aagaccaagt      1620
     ggggcactat cgaagttgag aataccactc actgtgaatt tgcttacctg cgggatctcc      1680
     ttatcaggac gcacatgcaa aacatcaaag acatcaccag caacatccac ttcgaagcct      1740
     accgagtgaa acgcctcaac gagggcaaca gcgccatggc caacgggatc gagaaggagc      1800
     cggaagccca ggagatgtag atgcgtcccg cccctggacc ccacccccag atcttttcat      1860
     catccctggc ccacccacct accctgtctt attttatata attatctcct tgtcacctgc      1920
     ctccatccat ctcttcccac actttgccag gtaacaagag agggtttacc tcccaagtgt      1980
     gctcttattg gctgcagcag cagggtgggc ggggctaagc ctgggcttgc ctctgtgctc      2040
     tatttccacc cgggctcagc ccctgagggg ttagaagagc tatgtgtccg tcccccgctc      2100
     tgagttctaa gctgaagcct gtgggggcca agtcctaggg ggtgcagagg agcccgttag      2160
     accacaagac cccatggccg cagcctcaag caggttagag actgccccaa aggaggatgg      2220
     agctggccgg gtattcctga aacctcacct gcccctccgg gggcgtttct tacagcgccc      2280
     tcagctgcct gcccctcaag ggaactagag gcgtcacagc caaagttgcc aatcacttag      2340
     acaaagtgac aaccgtgccc ctcgagcttg tcccagagca gaaagtgcct tgatctacaa      2400
     gagccagtca cctcttccca gatgtccctt tgggtgaaaa gcagggacgt gctggagaga      2460
     gggaggtatc ttttctccct cgcccttggg ttctctctcc cctgtgctgt agatatcgct      2520
     actacactgg gctttaatta taaaagacga agcgtgaaag atgctccccg atgttaggaa      2580
     gccccgcccc caatgtaagg aaggtcaaag caagaagatg agtcgaagcc atgagggagg      2640
     aagccgtgga agggaggcat aagagtgtgt gggagctctc ctgcccaggt gccgcggaag      2700
     gcatatccgc gtggtcctca gtttgggcca agatattctg gttacattga tgctccgctg      2760
     cctcaccctg tcccacccca cacaccccag gctcaagcct tgatgattca gtgactgtac      2820
     tgggtgggag ccagaaacct gaccattttg ttgtctacat gagcctagac tagccctgtg      2880
     ccccagaacc catcaaaaat acccctaaag agggaaagat gagggggtca gagatggata      2940
     gccaggctca ctcatcttct ctcagaggga acattaggga ccatccatgc acagctgacc      3000
     aaagccgtgt ccttcctgcc tgcctcccat tctcatttgc ccctgaggag aaagtttggt      3060
     gaggtgcgtt aggttggacc cgcttgggga aggtgcctct acagacccag ggctagcttt      3120
     ctgcagccca gaagtgcagt gggaggggtg gggtgcagac agatggagac gaacattgtt      3180
     tcctgctttg ggcgtctact ccctcatcca agcatggaag ggcccctcgt catgccctgt      3240
     ggccgaacag ttcgcttgcc agcttgccaa gttcttttgc caaaatcagg actttgaagg      3300
     aaatctccag cacgctggac ccagggcact ccggccttca ccagcccaag tgaccctggg      3360
     gatttagcag caacccggtc atcaggatga ctttgtgcct ctgtaaccag gtattgaaac      3420
     tgttcgtctc accaggccgg tccacgtggc cctctgctgg gggcttcctg gtgggggggc      3480
     agaaaagtct ctctctctct ctctctctct cttttttttt ttttttgtat aaataacaaa      3540
     gtgttgaaat gtatttcctg aaataaatgt ttcaaatac                             3579
//


spacer
spacer