spacer

EBI Dbfetch

ID   AK122331; SV 2; linear; mRNA; STD; MUS; 5185 BP.
XX
AC   AK122331;
XX
DT   15-MAR-2003 (Rel. 75, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus mRNA for mKIAA0623 protein.
XX
KW   FLI_CDNA.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5185
RA   Okazaki N., Kikuno R., Nagase T., Ohara O., Koga H.;
RT   ;
RL   Submitted (07-FEB-2003) to the INSDC.
RL   Hisashi Koga, Kazusa DNA Research Institute, Laboratory for Genome
RL   Informatics; 2-6-7   Kazusa-kamatari, Kisarazu, Chiba 292-0818, Japan
RL   (E-mail:mouse@kazusa.or.jp, Tel:81-438-52-3919, Fax:81-438-52-3918)
XX
RN   [2]
RX   DOI; 10.1093/dnares/10.1.35.
RX   PUBMED; 12693553.
RA   Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S.,
RA   Nakajima D., Nagase T., Ohara O., Koga H.;
RT   "Prediction of the coding sequences of mouse homologues of KIAA gene: II.
RT   The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs
RT   identified by screening of terminal sequences of cDNA clones randomly
RT   sampled from size-fractionated libraries";
RL   DNA Res. 10(1):35-48(2003).
XX
DR   MD5; a8cfa1e723ac6c926dd6ed61a83f6c1d.
DR   Ensembl-Gn; ENSMUSG00000004798; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000004920; mus_musculus.
XX
CC   The CREATE program supported by Japan science and technology
CC   corporation; cDNA full insert sequencing: Kazusa DNA Research
CC   Institute; cDNA library construction, clone selection and 5'- &
CC   3'-end one pass sequencing.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5185
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone="mbg01004"
FT                   /tissue_type="brain"
FT                   /note="vector:modified pBC SK+"
FT                   /db_xref="taxon:10090"
FT   CDS             <442..3612
FT                   /codon_start=1
FT                   /gene="mKIAA0623"
FT                   /product="mKIAA0623 protein"
FT                   /note="CDS is predicted by in silico analysis. Start codon
FT                   is not identified."
FT                   /db_xref="GOA:Q9QY01"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016237"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR022708"
FT                   /db_xref="MGI:MGI:1352758"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QY01"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAC65613.2"
FT                   /translation="SRFSATPAHPSALCPGGAAMEVVGDFEYCKRDLVGHGAFAVVFRG
FT                   RHRQKTDWEVAIKSINKKNLSKSQILLGKEIKILKELQHENIVALYDVQELPNSVFLVM
FT                   EYCNGGDLADYLQAKGTLSEDTIRVFLHQIAAAMRILHSKGIIHRDLKPQNILLSYANR
FT                   RKSNVSGIRIKIADFGFARYLHSNTMAATLCGSPMYMAPEVIMSQHYDAKADLWSIGTV
FT                   IYQCLVGKPPFQANSPQDLRMFYEKNRSLMPSIPRETSPYLANLLLGLLQRNQKDRMDF
FT                   EAFFSHPFLEQVPVKKSCPVPVPVYSGPVPGSSCSSSPSCRFASPPSLPDMQHIQEENL
FT                   SSPPLGPPNYLQVSKDSASNSSKNSSCDTDDFVLVPHNISSDHSYDMPMGTTARRASNE
FT                   FFMCGGQCQPTVSPHSETAPIPVPTQVRNYQRIEQNLISTASSGTNPHGSPRSAVVRRS
FT                   NTSPMGFLRVGSCSPVPGDTVQTGGRRLSTGSSRPYSPSPLVGTIPEQFSQCCCGHPQG
FT                   HEARSRHSSGSPVPQTQAPQSLLLGARLQSAPTLTDIYQNKQKLRKQHSDPVCPSHAGA
FT                   GYSYSPQPSRPGSLGTSPTKHTGSSPRNSDWFFKTPLPTIIGSPTKTTAPFKIPKTQAS
FT                   SNLLALVTRHGPAESQSKDGNDPRECSHCLSVQGSERHRSEQQQSKAVFGRSVSTGKLS
FT                   EQQVKAPLGGHQGSTDSLNTERPMDVAPAGACGVMLALPAGTAASARAVLFTVGSPPHS
FT                   ATAPTCTHMVLRTRTTSVGSSSSGGSLCSASGRVCVGSPPGPGLGSSPPGAEGAPSLRY
FT                   VPYGASPPSLEGLITFEAPELPEETLMEREHTDTLRHLNMMLMFTECVLDLTAVRGGNP
FT                   ELCTSAVSLYQIQESVVVDQISQLSKDWGRVEQLVLYMKAAQLLAASLHLAKAQVKSGK
FT                   LSPSMAVKQVVKNLNERYKFCITMCKKLTEKLNRFFSDKQRFIDEINSVTAEKLIYNCA
FT                   VEMVQSAALDEMFQQTEDIVYRYHKAALLLEGLSKILQDPTDVENVHKYKCSIERRLSA
FT                   LCCSTATV"
XX
SQ   Sequence 5185 BP; 1350 A; 1257 C; 1227 G; 1351 T; 0 other;
     accggcgcgc gcgcgtgcgt tgggcgctcc cgcgaagcag gcagaagccg ccaccgcggc        60
     tgtgcgggtt ccagggcggc ggccgctaca cagcagcgcc gcgggcgcaa caagcggagg       120
     cagccgcacc tgcggggatg gcgcggcccc ggccctgcac cgctgtcagg cgcgcgggta       180
     gctccgggta cgcccagtga cggcaggcgg tgccctcggc cgggcagtgc ccagccgctt       240
     ggctagagcc ccgcggccga cggcggcccg ggccatgaga agcgaccggg cccaggcctc       300
     gctgaccccg gctccgcgcg gcggcccgtc ccgtttccgc tccggcctct cggcatgagt       360
     gtccatccgg gcccggggcc gtggctgccc ctgtcccgcc gcccgcgggc gtgcttgggg       420
     ccctcgggcc cgcggtgctg atcccggttc tccgccacgc ctgcccaccc tagcgctcta       480
     tgtcccgggg gcgcggccat ggaggtggtg ggcgacttcg agtactgcaa gcgggacctc       540
     gtgggacacg gggccttcgc tgtggtcttc cgggggcggc accgccagaa aactgattgg       600
     gaggtggcta ttaaaagtat taataaaaag aacttgtcaa aatcacaaat tctgcttgga       660
     aaggaaataa aaatcttaaa ggagcttcag catgaaaaca tcgtagcgct ctatgatgtt       720
     caggaattgc ccaactctgt ctttctggtg atggagtatt gcaatggtgg agacctggca       780
     gattatttgc aagctaaagg aactctgagt gaagatacta tcagagtgtt tctccatcag       840
     attgcggcag ccatgcgaat cctgcacagc aaagggataa tccacaggga tctcaaacca       900
     cagaatatcc tgttgtctta tgccaatcga aggaagtcga atgtcagtgg tattcgtatt       960
     aaaatagctg attttggttt cgcacggtac ctacatagta acacaatggc agcgacactg      1020
     tgtggatccc caatgtacat ggctcccgag gttattatgt ctcaacatta tgatgctaag      1080
     gcagatttat ggagcatagg aacagtgatc tatcaatgcc tagttggaaa accacctttt      1140
     caggctaata gtcctcagga cctaaggatg ttttatgaaa aaaacaggag cttaatgcct      1200
     agtattccca gagaaacatc accttacttg gctaatctcc ttttgggttt gcttcagaga      1260
     aatcaaaagg atagaatgga ctttgaagca tttttcagcc atcctttcct tgagcaagtt      1320
     ccagttaaaa aatcttgccc agtcccagtg cctgtgtatt ctggccctgt ccctggaagc      1380
     tcctgcagca gctcaccatc ttgtcgcttt gcttctccac catcccttcc agatatgcag      1440
     catattcagg aagaaaactt atcctcccca ccgttgggtc ctcccaacta tctacaggtg      1500
     tccaaagact ctgcgagtaa tagtagcaag aactcttctt gtgacacgga tgactttgtt      1560
     ttggttccac acaacatctc gtcagaccac tcatatgaca tgccaatggg gactacggcc      1620
     agacgtgctt caaatgaatt ctttatgtgt ggagggcagt gtcaacctac tgtgtcacct      1680
     cacagcgaaa cagccccaat tccagttcct actcaagtaa ggaattatca gcgcatagaa      1740
     cagaatctta tatccactgc cagctctggc acaaacccac atggttctcc aagatctgca      1800
     gtagtacgaa ggtctaatac cagccccatg ggcttcctcc gggttgggtc ctgctcccct      1860
     gtaccaggag acacagtgca gacaggagga cgaagactct ctactggctc ttccaggcct      1920
     tactcaccat cccctttggt tggtaccatt cctgaacagt ttagtcagtg ctgctgtgga      1980
     catcctcagg gccatgaagc caggagtagg cactcctcag gttctccagt gccacagacc      2040
     caggcaccac agtcactctt actgggtgct agactgcaga gtgcacccac cctcaccgat      2100
     atctatcaga acaagcagaa gctcagaaag cagcactctg accctgtgtg tccgtcccat      2160
     gctggagctg ggtatagtta ctcacctcag cctagtcggc ctggcagcct tgggacctct      2220
     cccaccaagc acacggggtc ctctccacgg aattctgact ggttctttaa aactccttta      2280
     ccaacaatca ttggctctcc tactaagact acagctcctt tcaaaatccc taaaacacaa      2340
     gcatcttcta acctgttagc cttggttact cgtcatgggc ctgctgaaag ccagtccaaa      2400
     gatgggaatg accctcgtga gtgttcccac tgcctctcag tacaaggaag cgagaggcat      2460
     cgatctgagc agcagcagag caaggcagtg tttggcagat ctgtcagtac tgggaagtta      2520
     tcagaacaac aagtaaaggc acctttaggt ggacaccagg gcagcacgga tagtttaaac      2580
     acagaacgac caatggatgt agctcctgca ggagcctgtg gtgttatgct ggcattgcca      2640
     gcaggaacag cagcaagcgc cagagctgtc ctcttcaccg tggggtctcc tccacacagt      2700
     gccacagccc ccacttgtac tcatatggtc cttcgaacaa gaaccacctc agtggggtcc      2760
     agcagctcag gaggttcctt gtgttctgca agtggccgag tatgtgtggg ctcccctcct      2820
     ggaccagggt tgggctcttc cccaccagga gcagagggag ctcccagcct aagatacgtg      2880
     ccttatggtg cttcaccacc cagcctagag ggtctcatca cctttgaagc ccctgaacta      2940
     ccagaggaga cactgatgga gcgagagcac acagacacct tacgccatct gaacatgatg      3000
     ttaatgttta ctgagtgtgt gctggacctg acggcagtga ggggtgggaa ccctgagctg      3060
     tgcacatctg ctgtgtcctt gtaccagatt caggagagtg tagttgtgga ccagatcagc      3120
     cagctaagca aagattgggg gcgggtggag cagctggtgt tgtacatgaa ggcagcacag      3180
     ctgctggcgg cttccctgca tctcgccaaa gctcaggtca agtctgggaa gctgagccca      3240
     tccatggctg tgaaacaagt tgttaaaaat ctgaatgaaa gatacaaatt ctgcatcacc      3300
     atgtgcaaga aacttacaga aaagctgaat cgcttcttct ccgataaaca gagatttatt      3360
     gatgaaatca acagtgtgac tgcagagaaa ctcatctata attgtgctgt ggaaatggtt      3420
     caatctgcag ccctggatga gatgtttcag cagactgaag acatcgttta tcgctaccac      3480
     aaggcagccc ttcttttgga aggcttaagt aagatcctgc aggaccctac agatgttgaa      3540
     aatgtgcata agtataaatg tagtattgaa agaagattgt cagcactctg ctgtagcact      3600
     gcaactgtgt gagtagcagg cttgtctgtg gactggcatg gaacaggagg tgatacattt      3660
     gggattacat cttggttctg tcacccatcc caggacagtg tggtgactac caaagaacaa      3720
     gcagcagctt aagaaggaag aacaatacaa aactactaca tattgtagaa aacctgcctt      3780
     attggagaag tcactccccc tttcctttct cttcatagaa gcagaacaaa aagttttcca      3840
     catggctcaa gttatttgaa cctggcaaat aataaatgta ccttagaact agcatcataa      3900
     gtacagttat tcttgtggat aattaaacag gaaacaaagt gagtggcttc attcagctct      3960
     ctgagcaata catgaaattc cgtgttttgc taaagcatac acaagcaaaa gcgtatacag      4020
     ctcgtccaga cgatctgagg tttggggtaa gtttgtctga atctgagcct gcatctttaa      4080
     acagctcagg aggaggaatc ttaagaagaa acaaaaggtg actcttggat gaattgtgaa      4140
     atcttcaact tgatctaatg tggacatgat tttaatcttc caaaaatctt tcatattgca      4200
     ctaatttatt aaaataactg tgtattggat tttgcaattt aaaactaact gaggcacaat      4260
     ggacttgttt aaatatttta cttgattata tacatgtcct tttcagaatt catgtgtaat      4320
     ctccactgaa cttttaaatg gttggaaatt gcgttcatgt gaacctttgc atttttctca      4380
     cctgttatct tcaccaacag atcttagtgg aattttgagt tgctggttgt ttgcattttt      4440
     tgttgtgcat gcagaatgtg catcgactcc tgtgatctta ggtttactaa aggctaagtt      4500
     tatttgggca gtattagaaa gctatcatga atcaagaaat actcttgaga attttaatag      4560
     ggccaaatca aagtgatgaa taatggcttg ttagtgatgt ggagtttcta catgaaatta      4620
     gtaagaaatg aggttcgttt tcccttagga aatgggcagc tctctccaga ctaatgtgta      4680
     cttctcagtg ttaaccctga gttcaccata gctagtcatg gcagatcagc acctctccaa      4740
     gaatggttcc tgtgttgtat attatttggt atcttttact tacctgcttg aatacttgaa      4800
     taaaccattc accggtttta atccttttac ttcaaaactt acacatactg acctactctc      4860
     tgatagctgc acagaaactc tttggcgcca cacttgcttt agtgtgctga ttaaagttaa      4920
     cagagaaaac atggttttca tttacttggt gaacaaagta atgtaatttt tacattattt      4980
     atctgtatga aattccagca gttaatttga acgtttatgt ataggatgtt tgtattctta      5040
     ggtctttact acagtgtttc tacctctcat ttgtaactgc attatcttca aaataggtaa      5100
     aacccactaa gtcattgtgg aatagccttt tttaaattgc ttgtacaaat gtatattaag      5160
     gttaaataaa actgacagtg ttttt                                            5185
//


spacer
spacer