Dbfetch

ID   AK122298; SV 1; linear; mRNA; STD; MUS; 4639 BP.
XX
AC   AK122298;
XX
DT   15-MAR-2003 (Rel. 75, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus mRNA for mKIAA0511 protein.
XX
KW   FLI_CDNA.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4639
RA   Okazaki N., Kikuno R., Nagase T., Ohara O., Koga H.;
RT   ;
RL   Submitted (07-FEB-2003) to the INSDC.
RL   Hisashi Koga, Kazusa DNA Research Institute, Laboratory for Genome
RL   Informatics; 2-6-7   Kazusa-kamatari, Kisarazu, Chiba 292-0818, Japan
RL   (E-mail:mouse@kazusa.or.jp, Tel:81-438-52-3919, Fax:81-438-52-3918)
XX
RN   [2]
RX   DOI; 10.1093/dnares/10.1.35.
RX   PUBMED; 12693553.
RA   Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S.,
RA   Nakajima D., Nagase T., Ohara O., Koga H.;
RT   "Prediction of the coding sequences of mouse homologues of KIAA gene: II.
RT   The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs
RT   identified by screening of terminal sequences of cDNA clones randomly
RT   sampled from size-fractionated libraries";
RL   DNA Res. 10(1):35-48(2003).
XX
DR   MD5; 53927d1c784e91d250ee98e0a7ce35b0.
XX
CC   The CREATE program supported by Japan science and technology
CC   corporation; cDNA full insert sequencing: Kazusa DNA Research
CC   Institute; cDNA library construction, clone selection and 5'- &
CC   3'-end one pass sequencing.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4639
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone="mbg03508"
FT                   /tissue_type="brain"
FT                   /note="vector:modified pBC SK+"
FT                   /db_xref="taxon:10090"
FT   CDS             <450..3902
FT                   /codon_start=1
FT                   /gene="mKIAA0511"
FT                   /product="mKIAA0511 protein"
FT                   /note="CDS is predicted by in silico analysis. Start codon
FT                   is not identified."
FT                   /db_xref="GOA:Q80TY9"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR018297"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR030672"
FT                   /db_xref="InterPro:IPR032628"
FT                   /db_xref="MGI:MGI:99675"
FT                   /db_xref="UniProtKB/TrEMBL:Q80TY9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAC65580.1"
FT                   /translation="KQPAANMPRNQGFSDPEYSAEYSAEYSVSLPSDPDRGVGRTHEIS
FT                   VRNSGSCLCLPRFMRLTFVPESLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAV
FT                   VFSSDKLAPLMVAGFGLVLDIILFVLCKKGLLPDRVSRKVVPYLLWLLISAQIFSYLGL
FT                   NFSRAHAASDTVGWQAFFVFSFFITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQDE
FT                   LEGMQLLREILANVFLYLCAIIVGIMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQ
FT                   ENLMLSILPKHVADEMLKDMKKDESQKDQQQFNTMYMYRHENVSILFADIVGFTQLSSA
FT                   CSAQELVKLLNELFARFDKLAAKYHQLRIKILGDCYYCICGLPDYREDHAVCSILMGLA
FT                   MVEAISYVREKTKTGVDMRVGVHTGTVLGGVLGQKRWQYDVWSTDVTVANKMEAGGIPG
FT                   RVHISQSTMDCLKGEFDVEPGDGGSRCDYLDEKGIETYLIIASKPEVKKTAQNGLNGSA
FT                   VPNGAPASSKPSSPALIETKEPNGSAHASGSTSEEAEEQEAQADNPSFPNPRRRLRLQD
FT                   LADRVVDASEDEHELNQLLNEALLERESAQVVKKRNTFLLTMRFMDPEMETRYSVEKEK
FT                   QSGAAFSCSCVVLFCTAMVEILIDPWLMTNYVTFVVGEVLLLILTICSMAAIFPRSFPK
FT                   KLVAFSSWIDRTRWARNTWAMLAIFILVMANVVDMLSCLQYYMGPYNMTAGMELDGGCM
FT                   ENPKYYNYVAVLSLIATIMLVQVSHMVKLTLMLLVTGAVTALNLYAWCPVFDEYDHKRF
FT                   QEKDSPMVALEKMQVLATPGLNGTDRLPLVPSKYSMTVMMFVMMLSFYYFSRHVEKLAR
FT                   TLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQSYDEIGV
FT                   MFASLPNFADFYTEESINNGGIECLRFLNEIISDFDSLLDNPKFRVITKIKTIGSTYMA
FT                   ASGVTPDVNTNGFTSSSKEEKSDKERWQHLADLADFALAMKDTLTNINNQSFNNFMLRI
FT                   GMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETQVILREYGFRFV
FT                   RRGPIFVKGKGELLTFFLKGRDRPAAFPNGSSVTLPHQVVDNP"
XX
SQ   Sequence 4639 BP; 995 A; 1320 C; 1289 G; 1035 T; 0 other;
     ctcggctggc tcgccctgcg tgcggggaga ggatgctggc aagctgcccc ggcctgggcc        60
     cgccatccgc agcgcgcgcc gccgccgtcc tctgcgccca ccgatgctga gccgcagcct       120
     cgcgcctctc ccagcctgac ccggggcctg accgcgaggg gacccgcgca caggctccgg       180
     gtggacgagc tggcgcggcg gcactgcggg aagcagcctg cggctcgctg aagcccactt       240
     ggcttggctc cgcagccccg gtttggagcg cgcggctccc gagttcccgc acagatgttc       300
     ggtgccacct gtgtcctggg aacccactaa gcattccagc tccagttgga cgcccttcat       360
     tcataaccaa gaggaacctc cccgccttcc ccgggtctta cgaagccctg gtgaagtggc       420
     ttgacctgca ggtctccctt cctcattaga aacagccagc agccaacatg ccgaggaacc       480
     agggcttctc ggatcccgag tactcggcag agtactcagc tgaatactcg gtcagcctgc       540
     cctctgaccc cgaccgcggg gtcggccgga cccatgaaat ttctgtgcgg aactcggggt       600
     cctgcctgtg cctgcctcgc tttatgcggc tgaccttcgt gcctgagtcc ttggagaacc       660
     tctaccagac ctacttcaaa aggcagcgcc atgagaccct gctggtgctg gtggtctttg       720
     cggccctctt tgactgctac gtggtagtga tgtgcgcggt ggtcttctcc agcgacaagc       780
     tggcgcccct catggtggca ggcttcggtc tggtgttgga catcatcctt ttcgtgctct       840
     gtaaaaaggg gctgctcccg gaccgagtga gccgcaaagt ggtaccctac ctgctgtggc       900
     tgctcatctc ggcccagatc ttctcctacc tgggcctgaa cttttcacgg gcccacgcag       960
     ccagtgacac tgtgggttgg caggctttct ttgtcttctc cttcttcata acgctgcccc      1020
     tcagcctcag ccccatcgtg atcatctctg tggtctcctg tgttgtgcac acgcttgtgt      1080
     tgggggtcac tgtggcccag cagcagcagg atgagctgga agggatgcag ctgctgaggg      1140
     agatcctggc caacgtcttc ctctacctgt gtgctatcat cgtgggcatc atgtcctact      1200
     acatggcaga ccgcaagcac cgcaaggcct tcctggaggc ccgccagtca ctggaggtga      1260
     agatgaatct ggaggagcag agccagcagc aggaaaacct tatgctttcc atcctgccca      1320
     agcacgtggc tgacgagatg ctgaaggaca tgaagaagga cgagagccag aaggaccagc      1380
     agcagttcaa taccatgtac atgtaccggc acgagaatgt cagcatcctg tttgcagata      1440
     ttgtgggctt tacccagctg tcctctgctt gcagtgccca ggagctcgtg aagttactca      1500
     acgagctctt cgcccgcttt gacaagctgg cagccaaata ccaccagctg aggatcaaga      1560
     tcctaggcga ctgttactac tgcatctgcg gcttgcctga ctaccgggag gaccatgccg      1620
     tgtgctccat ccttatgggg cttgccatgg tagaggccat ctcgtacgtg cgggagaaga      1680
     ccaagactgg agtggacatg cgtgtgggag tgcacacagg cactgtccta ggcggtgtcc      1740
     tgggccagaa gcgctggcag tatgatgtat ggtctactga tgtcaccgtg gcaaacaaga      1800
     tggaggctgg tggcatccca gggcgcgtgc acatttccca gagcaccatg gactgcctga      1860
     agggggagtt tgatgtggag cctggtgatg ggggcagtcg ctgcgactac ctagatgaga      1920
     agggcatcga aacctacctc atcattgcct ccaagccaga ggtgaagaaa acagcccaaa      1980
     atggcctcaa cggctcggcc gtgccaaacg gagcgccggc atcctccaaa cccagctccc      2040
     ctgccctcat cgagaccaag gagcccaatg gaagtgccca tgccagcggc tccacatcag      2100
     aggaggctga agaacaggag gcccaggctg acaacccctc gttccccaac ccccgccgca      2160
     ggctgcgcct ccaggacctg gcggaccgtg tggtggacgc ctctgaggat gagcacgaac      2220
     tgaaccagct gcttaatgag gccctgctgg agcgggagtc cgcccaggtg gtaaagaaga      2280
     gaaacacatt cctcctgacc atgaggttca tggacccaga gatggaaaca cgctactcgg      2340
     tggagaagga gaagcagagc ggggctgcct tcagctgctc ctgtgtggtc ctcttctgca      2400
     cggccatggt ggagatactc attgacccct ggctgatgac aaactatgtg acctttgtgg      2460
     ttggggaggt tctgctcctg atcctgacca tctgctcgat ggctgccatc tttcccaggt      2520
     catttcccaa gaagcttgtg gccttctcat cttggattga ccggacccgc tgggcaagga      2580
     acacctgggc catgttagcc atcttcattc tggttatggc caatgttgtg gacatgctca      2640
     gctgtctcca gtactacatg ggaccttaca acatgacagc tgggatggag ctggacggcg      2700
     gctgcatgga gaaccccaag tactacaact acgtagctgt gctgtcgctc atcgccacca      2760
     tcatgctggt gcaggtcagc cacatggtga agctgacgct catgctgctc gtcacaggcg      2820
     ccgtgactgc cctcaacctg tacgcctggt gtcctgtctt tgatgaatac gaccacaagc      2880
     gctttcagga aaaggactct cctatggtgg ccttagagaa gatgcaggta cttgccaccc      2940
     ctgggctcaa tggcactgac aggctgcccc tggtgccttc caagtactcc atgactgtga      3000
     tgatgttcgt catgatgctg agcttttact acttctcgcg ccacgtggaa aaactggccc      3060
     gaacactgtt cttgtggaag attgaggtcc atgaccagaa agaacgtgtc tacgagatgc      3120
     gccgatggaa cgaggccttg gtcaccaaca tgttgcctga gcatgttgca cgccattttc      3180
     tggggtccaa gaagagagat gaggagctgt acagccagtc ttatgacgag attggagtca      3240
     tgtttgcctc cttgcccaac tttgctgact tctacactga ggagagcatc aacaacggcg      3300
     gcatcgagtg tctacgcttc ctcaatgaga tcatctctga ttttgactct ctcctggaca      3360
     atcccaaatt ccgggtcatc accaagatca aaactattgg cagcacctat atggcagctt      3420
     caggagtcac accagatgtc aacaccaatg gctttacaag ctccagcaag gaggagaagt      3480
     cagacaagga gcgctggcag cacctggctg acctggctga ctttgcatta gccatgaagg      3540
     acacgctcac aaacatcaac aaccagtcat tcaacaactt catgttgcgc ataggcatga      3600
     acaaaggagg ggttctggct ggcgtcattg gagcccggaa accacactat gacatctggg      3660
     gcaatacggt caatgtggcc agcaggatgg aatccacagg agtcatgggc aacatccagg      3720
     tggtagaaga gacgcaggtc atccttcgag agtacggctt ccgctttgtg aggcgaggtc      3780
     ccatctttgt gaaaggcaaa ggggagcttc tgaccttttt cttgaagggg cgggacaggc      3840
     cagctgcctt ccccaatggc tcctctgtta cactgcccca ccaagtggtg gacaacccct      3900
     gagcgacctc tggctccaca gtggtccaca taggaagggg gatttttttg gaagcagtga      3960
     aaagctttgg gaaaggacaa atgaccaagt cctggtgttc ccaattattg aagcgcacat      4020
     tccatagact ttaggtttca gatttcctcc agccttcctg tgtggatgtg agctctgagg      4080
     gtggctattc ctactcctca gtgagcctgt agcttcccca aagcaggagt cttaggcata      4140
     gtactggagc agcctttcca gagcctttgt tccagctcag cccttcaccc ctagagaggc      4200
     catggccact gtgagcagga tgccagccga ggcggaacga agctgcctgt gctgggggcg      4260
     gggagctccg gttgggctca gggctgagga ggctctgcac ccggctgctc cttcctgtct      4320
     ggttaggtca atggccctta ccccacccac tgttcctgat aatcttgaaa ggttcttctg      4380
     gaacccgtgt caccttagtc acgagagcag aaagtgcaat atttcctttc acctggttgg      4440
     gaaggggggt tatttctgaa agaaaaatat ataaacagat cttctacatt tatattttta      4500
     acctgttcaa aaaacaactt tccaatattg ccttgtcttc tgagctcttg ctacagtcgc      4560
     ctttgctact gctttaacaa agaatctgca ggtgttgata aagaacagga ctgttttatt      4620
     aaaagcttta ctcaacttg                                                   4639
//