Dbfetch

ID   AK122252; SV 1; linear; mRNA; STD; MUS; 5608 BP.
XX
AC   AK122252;
XX
DT   15-MAR-2003 (Rel. 75, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus mRNA for mKIAA0343 protein.
XX
KW   FLI_CDNA.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5608
RA   Okazaki N., Kikuno R., Nagase T., Ohara O., Koga H.;
RT   ;
RL   Submitted (07-FEB-2003) to the INSDC.
RL   Hisashi Koga, Kazusa DNA Research Institute, Laboratory for Genome
RL   Informatics; 2-6-7   Kazusa-kamatari, Kisarazu, Chiba 292-0818, Japan
RL   (E-mail:mouse@kazusa.or.jp, Tel:81-438-52-3919, Fax:81-438-52-3918)
XX
RN   [2]
RX   DOI; 10.1093/dnares/10.1.35.
RX   PUBMED; 12693553.
RA   Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S.,
RA   Nakajima D., Nagase T., Ohara O., Koga H.;
RT   "Prediction of the coding sequences of mouse homologues of KIAA gene: II.
RT   The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs
RT   identified by screening of terminal sequences of cDNA clones randomly
RT   sampled from size-fractionated libraries";
RL   DNA Res. 10(1):35-48(2003).
XX
DR   MD5; 3afecf6e2a44f0a6cd2e93e42e2c50c9.
DR   Ensembl-Gn; ENSMUSG00000020598; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019712; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0019676; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0019647; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019654; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019458; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020101; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019011; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0019430; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0019543; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0019532; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0019613; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019568; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020141; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018778; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019061; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000020939; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110748; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0034773; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0034698; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0034682; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0034696; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0034476; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0035195; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0034398; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0034390; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0034533; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0034524; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0034672; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0034534; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0035243; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0034079; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0033940; mus_musculus_wsbeij.
XX
CC   The CREATE program supported by Japan science and technology
CC   corporation; cDNA full insert sequencing: Kazusa DNA Research
CC   Institute; cDNA library construction, clone selection and 5'- &
CC   3'-end one pass sequencing.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5608
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone="mbg04270"
FT                   /tissue_type="brain"
FT                   /note="vector:modified pBC SK+"
FT                   /db_xref="taxon:10090"
FT   CDS             <425..4033
FT                   /codon_start=1
FT                   /gene="mKIAA0343"
FT                   /product="mKIAA0343 protein"
FT                   /note="CDS is predicted by in silico analysis. Start codon
FT                   is not identified."
FT                   /db_xref="GOA:Q810U4"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013098"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR026966"
FT                   /db_xref="MGI:MGI:104750"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q810U4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAC65534.1"
FT                   /translation="EKKRKFRAWVSAGVQLMQLKIMPKKKHLSAGGVPLILFLCQMISA
FT                   LDVPLDLVQPPTITQQSPKDYIIDPRENIVIQCEAKGKPPPSFSWTRNGTHFDIDKDPL
FT                   VTMKPGSGTLVINIMSEGKAETYEGVYQCTARNERGAAVSNNIVVRPSRSPLWTKERLE
FT                   PIVLQNGQSLVLPCRPPIGLPPAIIFWMDNSFQRLPQSERVSQGLNGDLYFSNVLPEDT
FT                   REDYICYARFNHTQTIQQKQPISLKVISVDELNDTIAANLSDTEFYGAKSSKERPPTFL
FT                   TPEGNESHKEELRGNVLSLECIAEGLPTPIIYWIKEDGMLPANRTFYRNFKKTLQITHV
FT                   SEADSGNYQCIAKNALGAVHHTISVTVKAAPYWIVAPQNLVLSPGENGTLICRANGNPK
FT                   PRISWLTNGVPIEIALDDPSRKIDGDTIIFSNVQESSSAVYQCNASNKYGYLLANAFVN
FT                   VLAEPPRILTSANTLYQVIANRPALLDCAFFGSPMPTIEWFKGTKGSALHEDIYVLHDN
FT                   GTLEIPVAQKDSTGTYTCVARNKLGMAKNEVHLEIKDPTRIIKQPEYAVVQRGSKVSFE
FT                   CRVKHDHTLIPTIMWLKDNGELPNDERFSTDKDHLVVSDVKDDDGGTYTCTANTTLDSA
FT                   SASAVLRVVDVPNPPFDLELTNQLDKSVQLTWTPGDDNNSPITKFIIEYEDAMHDAGLW
FT                   RHQAEVSGTQTTAQLKLSPYVNYSFRVMAENSIGRSMPSEASEQYLTKAAEPDQNPMAV
FT                   EGLGTEPDNLVITWKPLNGFQSNGPGLQYKVSWRQKDGDDEWTSVVVANVSKYIVSGTP
FT                   TFVPYLIKVQALNDVGFAPEPAAVMGHSGEDLPMVAPGNVRVSVVNSTLAEVHWDPVPP
FT                   KSVRGHLQGYRIYYWKTQSSSKRNRRHIEKKILTFQGTKTHGMLPGLQPYSHYALNVRV
FT                   VNGKGEGPASTDRGFHTPEGVPSAPSSLKIVNPTLDSLTLEWDPPSHPNGILTEYILQY
FT                   QPINSTHELGPLVDLKIPANKTRWTLKNLNFSTRYKFYFYAQTSVGPGSQITEEAITTV
FT                   DEGKKAMASRQVDIATQGWFIGLMCAVALLILILLIVCFIRRNKGGKYPVKEKEDAHAD
FT                   PEIQPMKEDDGTFGEYSDAEDHKPLKKGSRTPSDRTVKKEDSDDSLVDYGEGVNGQFNE
FT                   DGSFIGQYSGKKEKEPAEGNESSEAPSPVNAMNSFV"
XX
SQ   Sequence 5608 BP; 1633 A; 1279 C; 1314 G; 1382 T; 0 other;
     cgggcgcgag ggaccgtgca gaaacggaga ctggggcagc tggaggcgac agcttcggaa        60
     gcttcggaaa cacgcacgac agctgggctc cggggtctta ggcagtagcg ccccggcagg       120
     gaggtgggcg cggcacgaaa acgaattttt gtgctgctct ccagtgaaag ccagtacccc       180
     tatttgctga aggcttttta accaaggctg ctttcagctc ttgacattac ccagagaaaa       240
     ggtggactca gaaatcaggg aagcattgga ggtttctgac cctgaggatc ttctgaagag       300
     caatgctaag aaaacctttg gcttaaggaa ttaaaacgaa ataccacttc ttcaagtaag       360
     aagacctact tcaaagtccc ctgcatgaaa aattatttaa acgccgcaca ccaatcttcc       420
     gtgagagaag aaaaggaaat tccgtgcgtg ggtctcagca ggagtgcagc tgatgcagct       480
     taaaataatg ccgaagaaga agcacttatc tgcaggcgga gtgcccctga ttctcttcct       540
     gtgccagatg atcagcgcgc tggatgttcc tctcgatctg gtacaacctc caaccatcac       600
     tcaacagtca ccaaaagact acatcattga ccctcgggag aatattgtaa tccagtgtga       660
     ggccaaaggg aaacctcccc caagcttttc ctggactcgt aatggaactc actttgacat       720
     agacaaggac cctctggtca ccatgaagcc tggctcagga acccttgtca tcaacatcat       780
     gagtgagggg aaggcagaga cctatgaagg agtctaccag tgcactgcaa ggaacgagcg       840
     tggagctgcc gtctccaata acattgttgt ccgcccatct aggtcaccct tgtggaccaa       900
     ggaaagactt gaacctatag tactccagaa tgggcagtca ttagtacttc catgtaggcc       960
     tccgattgga ttacctccgg ccataatatt ttggatggat aattcctttc agagacttcc      1020
     acagagtgag cgggtttccc aaggcctaaa tggagacctt tacttctcca atgtcctccc      1080
     agaggacacc cgtgaggact atatctgcta tgccagattt aatcacactc aaaccatcca      1140
     gcagaagcag cctatttctt tgaaggtgat ttcagtggat gaattgaatg acactatagc      1200
     tgctaatttg agtgacactg agttttatgg tgctaaatct agtaaagaga ggcccccaac      1260
     gtttctaact ccagagggca atgaaagcca caaagaggaa ttaagaggaa acgtgctttc      1320
     gctggagtgc attgcggaag gcctacctac tccaattatt tactggatca aagaagacgg      1380
     aatgcttccc gccaaccgga cattttatcg gaactttaag aaaaccctgc agatcactca      1440
     tgtttccgaa gccgactctg gaaattatca gtgcatagca aaaaacgcat taggagccgt      1500
     ccatcacacc atttctgtca ctgttaaagc ggctccctac tggatcgtgg cacctcaaaa      1560
     cctcgtgctt tccccgggag agaatgggac cctcatctgc agagctaatg gcaacccgaa      1620
     acccagaatt agctggttaa caaatggagt cccaatagaa attgctctcg atgaccccag      1680
     cagaaaaata gatggcgata ccattatatt ttcaaatgtt caagaaagct caagtgcggt      1740
     ttatcagtgc aatgcctcta acaaatatgg atatttacta gcaaatgcat ttgtaaatgt      1800
     tctcgctgaa ccacctcgga ttctcacatc agcaaacaca ctgtaccagg tcattgcaaa      1860
     caggcctgct ttgctagatt gtgccttctt tggatctcct atgcctacca ttgagtggtt      1920
     taaaggcact aaaggaagcg ctcttcatga agacatttat gttttgcatg ataatggaac      1980
     attagaaatt cccgtggccc aaaaggatag tacagggacg tatacttgtg tcgcacggaa      2040
     taaactaggg atggcaaaga atgaagttca cttggaaatc aaagatccaa ccaggatcat      2100
     taaacaacct gagtatgcag tcgtccagag ggggagcaag gtgtcctttg aatgcagagt      2160
     gaaacatgac cacaccttaa tccccaccat tatgtggctg aaggacaatg gagagctgcc      2220
     caatgatgaa aggttctcca ctgacaagga tcatctggtg gtatctgatg taaaggatga      2280
     cgatggcgga acctacacgt gtacggccaa cacaacgctg gacagtgctt cggccagcgc      2340
     tgtgctcagg gttgtcgatg tcccgaatcc tccctttgat ttagaattga ccaatcaact      2400
     tgacaaaagt gttcagctga catggacccc aggcgacgac aacaatagcc ccattacaaa      2460
     attcatcatt gagtatgaag atgcaatgca tgatgcaggg ctgtggcgcc accaggctga      2520
     agtttctgga acacagacca cagcccaact gaagctgtct ccctatgtga actactcctt      2580
     ccgtgtcatg gcagagaaca gcattgggag aagtatgccg agcgaggcat ccgagcagta      2640
     tcttacaaaa gccgcagaac cagatcagaa tcccatggct gtggaaggac tagggacaga      2700
     gccggacaac ttggtgatta catggaagcc cctgaatggt tttcaatcga atgggcctgg      2760
     cctccagtac aaagtgagct ggcgccagaa agatggtgac gatgagtgga cgtctgtggt      2820
     tgtggccaat gtatccaaat acattgtttc tggcacacca acctttgtcc catacctgat      2880
     aaaagttcaa gctctgaatg atgtggggtt tgcaccagag ccagctgcag tcatggggca      2940
     ttctggagaa gaccttccaa tggtggctcc tggaaatgtt cgcgtcagcg tggtgaacag      3000
     tacgctggca gaggtgcact gggacccagt tcctcccaag agtgtccgag gacacttaca      3060
     aggctaccgg atttactact ggaagaccca gagctcctct aaaagaaaca ggcgccacat      3120
     tgagaagaag atcctcacct tccagggcac caagactcac ggcatgctgc cagggctgca      3180
     gccatacagt cactatgccc tcaacgtccg agtggtcaac gggaaagggg agggcccagc      3240
     cagcacggac agaggcttcc atacaccgga gggagtccct agtgctccct catctttgaa      3300
     aattgttaat cccacactgg actccctcac tttggaatgg gaccccccaa gccacccaaa      3360
     tggcatcctg actgagtaca tcttacaata tcagccaatt aacagcacac atgagctagg      3420
     ccctctggta gatttaaaaa ttcctgccaa caagacccgc tggactttga aaaatttaaa      3480
     tttcagcact cggtacaagt tctatttcta tgcacagaca tcagtggggc caggcagtca      3540
     gatcacagag gaagcgataa cgactgtgga cgaaggtaag aaggcaatgg caagccggca      3600
     agtggatatc gcgacccaag gctggttcat aggtctaatg tgcgctgttg ctctcctcat      3660
     cttaattttg ctgattgttt gcttcatcag aagaaacaaa ggtggtaaat acccagttaa      3720
     agaaaaggag gatgctcatg cagaccctga aatccagccc atgaaggaag atgatgggac      3780
     gtttggagaa tacagtgatg cagaagatca caagcctttg aaaaaaggaa gtcgaacacc      3840
     ttcagacagg actgtgaaaa aagaagatag cgatgatagt ctggttgact atggagaggg      3900
     ggtgaacggc caattcaacg aggatggctc ctttattggc caatacagtg gtaagaaaga      3960
     gaaagagcca gcagagggaa atgaaagctc agaggcccct tctcctgtca acgcaatgaa      4020
     ctcctttgtt taagtcttta agctctgtgc caatgtctaa tctctctgga atggttttcc      4080
     tgaacacctg tcatccctct catactacgg acatatgggt agaaagaatg ttttctgcgg      4140
     tatatgagta ttatgagacc agagcaagaa catgactcag tcaaatgata cattaatatg      4200
     aactggggtg caaagtgcat acgtttttgt tcagagtggg gtttttctca atttccttgg      4260
     aactgattaa aaagaaatac aacatcatca atagattaca ttattccctg tgcgggatcc      4320
     agttcaatac gatgcatgag acatgctgca cagaggacac acctgtgtat gtgactgcga      4380
     tgtggttggg tactttgttg gcactatcct cagctgatcc ctaaatatga attccgttgt      4440
     cattgtgaag agtgttgctg tagtgttctc tagagcttca atgtctctgt ggacattgtt      4500
     gttaaactcg tgactatgtc tagctggtgt tagtcttttt gagagactat taggaacagt      4560
     gtgtacagta tatacttgct acatgagtta cttatgacag ttgcatccac taatgctcgc      4620
     tgagactctg aaacctgttc tttgctcccg gaccttccta ggctttttat ccttccgggt      4680
     gtcacagcag cagagtccca cttactatac tatctgcgtt cagtcctttg gggggcataa      4740
     acattgcgta ttgtgacacc tgctggcatt tgtgccctac tcaaagaatt gaagtcaaag      4800
     ctctcaagtg aaattttaaa ttttagttca gaaaatgcag ggcaagacac acgcagtgcc      4860
     ttcagacaat tagcattccc tgactcctgt actctgtatc agccagtgtg ggcaacttca      4920
     tcctacgcta ctgttgttgg aaaggaactt ttccaaggca gagataattc gaactgaaac      4980
     tgggagcata ggaacaactt tatttgaagt ggtgttcccc acacaaatat caggcctcca      5040
     aagctctgtc attgtcgggt gtacaggatg gttttgttgt cttttgtggt ttctagccaa      5100
     acaagtcaag ttgaaaaaag gaaaaaatgg tatggttgga aatggataga aaacccaatg      5160
     attgcagaag taaaagcgta caacagcatg cctaaagtac taaatgattc actctgccta      5220
     gacaagcttt caaattccgc agcattcagc aacgtgtatg caaattgcaa caggcacact      5280
     ccagaacctg agaaacctga ccagtgctta attaggccag cagtcaaaga gattacacct      5340
     cgagtctaaa gaacaatact atatcctatc atagccataa acaatgtgtg tgaaatggct      5400
     tacctccaat atagaaacct atgaccacct atggttgaag ggatgctcag tttcatttgc      5460
     caataaattg gtttctcata acttgcatca agtttaattt taagtaaagc cttttatatg      5520
     taggtattct gttgaatttg taaatatact tagagtgtag aagctatatg ctcataggta      5580
     ttacgtgcaa ataaacatgc aatcaatg                                         5608
//