Dbfetch

ID   AK122232; SV 1; linear; mRNA; STD; MUS; 3969 BP.
XX
AC   AK122232;
XX
DT   15-MAR-2003 (Rel. 75, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus mRNA for mKIAA0267 protein.
XX
KW   FLI_CDNA.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3969
RA   Okazaki N., Kikuno R., Nagase T., Ohara O., Koga H.;
RT   ;
RL   Submitted (07-FEB-2003) to the INSDC.
RL   Hisashi Koga, Kazusa DNA Research Institute, Laboratory for Genome
RL   Informatics; 2-6-7   Kazusa-kamatari, Kisarazu, Chiba 292-0818, Japan
RL   (E-mail:mouse@kazusa.or.jp, Tel:81-438-52-3919, Fax:81-438-52-3918)
XX
RN   [2]
RX   DOI; 10.1093/dnares/10.1.35.
RX   PUBMED; 12693553.
RA   Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S.,
RA   Nakajima D., Nagase T., Ohara O., Koga H.;
RT   "Prediction of the coding sequences of mouse homologues of KIAA gene: II.
RT   The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs
RT   identified by screening of terminal sequences of cDNA clones randomly
RT   sampled from size-fractionated libraries";
RL   DNA Res. 10(1):35-48(2003).
XX
DR   MD5; 3295a3ca03165f6603231a6112541beb.
XX
CC   The CREATE program supported by Japan science and technology
CC   corporation; cDNA full insert sequencing: Kazusa DNA Research
CC   Institute; cDNA library construction, clone selection and 5'- &
CC   3'-end one pass sequencing.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3969
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone="mbh01806"
FT                   /tissue_type="brain"
FT                   /note="vector:modified pBC SK+"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..2105
FT                   /codon_start=3
FT                   /gene="mKIAA0267"
FT                   /product="mKIAA0267 protein"
FT                   /note="CDS is predicted by in silico analysis. Start codon
FT                   is not identified."
FT                   /db_xref="GOA:Q80U52"
FT                   /db_xref="InterPro:IPR002090"
FT                   /db_xref="InterPro:IPR004709"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="MGI:MGI:2443511"
FT                   /db_xref="UniProtKB/TrEMBL:Q80U52"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAC65514.1"
FT                   /translation="GARRGWRLAPVRRGVCGPRARPLMRPLWLLFAVSFFGWTGALDGS
FT                   GGTTRAMDEEIVSEKQAEESHRQDSANLLIFILLLTLTILTIWLFKHRRARFLHETGLA
FT                   MIYGLLVGLVLRYGIHVPSDVNNVTLSCEVQSSPTTLLVNVSGKFYEYTLKGEISSHEL
FT                   NNVQDNEMLRKVTFDPEVFFNILLPPIIFYAGYSLKRRHFFRNLGSILAYAFLGTAISC
FT                   FVIGSIMYGCVTLMKVTGQLAGDFYFTDCLLFGAIVSATDPVTVLAIFHELQVDVELYA
FT                   LLFGESVLNDAVAIVLSSSIVAYQPAGDNSHTFDVTAMFKSIGIFLGIFSGSFAMGAAT
FT                   GVVTALVTKFTKLREFQLLETGLFFLMSWSTFLLAEAWGFTGVVAVLFCGITQAHYTYN
FT                   NLSTESQHRTKQLFELLNFLAENFIFSYMGLTLFTFQNHVFNPTFVVGAFIAIFLGRAA
FT                   NIYPLSLLLNLGRRSKIGSNFQHMMMFAGLRGAMAFALAIRDTATYARQMMFSTTLLIV
FT                   FFTVWVFGGGTTAMLSCLHIRVGVDSDQEHLGVPDNERRTTKAESAWLFRMWYNFDHNY
FT                   LKPLLTHSGPPLTTTLPACCGPIARCLTSPQAYENQEQLKDDDSDLILNDGDISLTYGD
FT                   STVNTESATASAPRRFMGNSSEDALDRELTFGDHELVIRGTRLVLPMDDSEPALNSLDD
FT                   TRHSPA"
XX
SQ   Sequence 3969 BP; 966 A; 841 C; 931 G; 1231 T; 0 other;
     ctggggctcg gcgcggctgg cggctggcgc ccgttcgccg tggcgtctgc gggccccggg        60
     cgcgtccgct catgcggccc ctttggttgc tcttcgcagt gagcttcttt ggctggaccg       120
     gggctctgga cggctccggg ggaacgacca gagccatgga cgaggagatc gtgtccgaga       180
     agcaggcgga ggagagccat cggcaggaca gcgccaacct gctcatcttc atcctgctgc       240
     tcaccctcac cattctgacg atctggctct tcaagcaccg ccgggcccgc ttcctgcacg       300
     aaaccggcct tgctatgatt tatggtcttt tggtaggcct cgtgcttcgg tacggcattc       360
     atgttccaag cgatgtgaat aatgtgactc tgagctgtga agtgcagtca agtccaacta       420
     ccttgttggt caacgtcagt ggaaaatttt atgagtatac gctgaaagga gagattagct       480
     cacatgaact caacaatgtt caagataatg aaatgcttag gaaggttact tttgatccag       540
     aagtcttttt caacatactg cttcctccta tcatatttta tgcagggtac agtctcaaaa       600
     ggagacattt cttccggaac cttgggtcta tcttagcata tgcctttctt ggaacagcaa       660
     tttcttgttt cgttattggg tccatcatgt atggctgtgt aaccctgatg aaggtgaccg       720
     ggcagctcgc gggagatttt tactttacag attgcttgct gtttggtgcc attgtttcag       780
     ccaccgaccc agtgactgtt cttgccatct tccatgagct tcaagttgac gttgaactct       840
     acgctcttct cttcggggaa agtgtcctca atgacgcggt tgccatagtg ctgtcctcct       900
     caatagtggc ataccagcca gcgggagaca acagccacac ctttgacgtt acagccatgt       960
     tcaaatctat tggaatcttc cttgggatct tcagtggatc ttttgcaatg ggtgctgcaa      1020
     caggcgtggt aacagcttta gtgacaaagt tcacaaagct gagagagttc cagctgttgg      1080
     agacaggcct tttcttcttg atgtcctgga gcacctttct tctggctgaa gcatggggtt      1140
     tcacaggtgt ggttgcagta ttgttttgtg gcatcacaca agcacattac acgtacaata      1200
     atttgtctac agagtctcag catagaacaa agcagttgtt tgagcttctc aattttttag      1260
     cggagaattt catcttttcc tacatggggc tgacgctgtt caccttccag aatcacgtct      1320
     ttaacccaac atttgtcgta ggagcattca ttgctatttt cttgggaaga gctgccaata      1380
     tttatccctt gtctctctta cttaatttgg gtagaagaag taagattgga tcaaattttc      1440
     aacacatgat gatgtttgct ggtcttcgtg gtgcaatggc atttgccttg gccattcgag      1500
     atactgccac ttatgcacga caaatgatgt tcagcaccac acttctgatc gtgtttttta      1560
     ctgtgtgggt atttggtggt ggcaccactg ccatgctgtc atgcctgcat ataagggttg      1620
     gtgttgattc agaccaagaa catttgggtg ttcctgacaa cgaaaggaga accaccaaag      1680
     cagagagtgc ctggctcttt cggatgtggt acaacttcga tcataactat ctgaagcccc      1740
     tgctgaccca cagtgggcct cctctgacta ccacactccc agcctgctgt gggccaatcg      1800
     ccaggtgcct gaccagcccc caagcatatg aaaaccagga gcagttgaaa gatgatgact      1860
     ctgatctcat tctcaatgat ggtgatatca gtctgacata tggggattct actgtgaaca      1920
     ccgagtccgc aacagccagc gccccaagga gatttatggg caacagttct gaagatgcct      1980
     tggaccggga gcttacattt ggggaccacg aactagtcat tcgtggcaca cgcctggttc      2040
     ttccgatgga tgattctgaa cctgcgttaa attcattaga tgatacgaga cacagtccgg      2100
     cctaagcgct ctgatgctca gttagtggtt tgtaaacttt gcacatgtga ttgtgaagaa      2160
     atgtgtacta cctacaagtc ctagtgcatg tctctgaatg tgtaagctat ataaatgccg      2220
     tttatatggc ataggaagaa tataaatacc ctgtacaagg cagattgtga aaaaaactgt      2280
     tctcttaagt ttttctggct ttactacata ttggccagat ctgttttaga aacttacttt      2340
     cacagtgatg ttctgtgttc tgttactttt atgtttcagt taaagcataa aaagtgacgg      2400
     attgactctt tcttatattt atctgagtac cgagttcttg tgctgtgagt taatttgtgt      2460
     gtggcaggga aggggaggga agggggagct gttattccct cgggaacccg ggaggagagg      2520
     ttcctttgtt ggaaaaactt ttgttgattg ctgctgcctt tgtcgtgact ttttctttcc      2580
     cttttctctg gtggcccttt gtggtgcaag gagctgatgg cattttgatc tcaccccatt      2640
     caggttgggg actgaagtgt gggggccgtt ttcccccatt gatgtgaaag aacagatttc      2700
     ttgactacag tacattgatg ctctgagaaa gaaggctaca aatgacctcc aagaccttat      2760
     ttcttttctt tcacaccaag accataggaa ttgcatccag ctggcttagc taaaatacag      2820
     gtgtatatcg ttcagggcac ttgttacaga tttgagggcg ctggagcaag tggacatggg      2880
     gatagtggtg ttggaggtct ctcttcccaa atatgtaaat agtctatacc agataagttg      2940
     aaataggaaa tgtacttgct gcttcatttt tgattatgtt cattgtgtgt atagcaagcc      3000
     ttgtcaccag aagttttttt tatatcaact taaatcgctg ctctttagca gccgaacagg      3060
     agcaaaatgt aaaattttta aactcgttat gtttaaaggt cacttgttag ttgatagtta      3120
     atgttaaaag ttaatttatg aacccacacc tgttctgtac tgcaccagag gcggccgtga      3180
     gagggatgca gtgttctgca ttctttgaag ggattctcct ggtgtaaagt gggtgcgctt      3240
     gttgtcttca ttgtcgtgtt actttttaat aatagacacc taagctgcca tgtgttactt      3300
     tttgatggtt tttgaggaag agcacagaac aaattttcat ttcatattca tagtatgaaa      3360
     gtggtttcta ttttgtaatg ctgcaaatac ctaaaggtac attgaacact tggaagggaa      3420
     cactttttga tgctgattct gacctgtttc tgattcagga gaaaaagata caaatcttgt      3480
     ggatttttct ccctcaggtc caagtagcat tgccttaaat ctaacccaat tagaaacttg      3540
     attacttatg tgacgttcaa attttccact gaaaaatacc cttccaaaca aagcacgcac      3600
     ttactctcaa aagggttctg tgccattgcc aacactcctt gagactttac aggaattctc      3660
     atggtgtacc cttcgtggca gccttgactg ttggcatagc catttgttat gtagtggtag      3720
     tgactttcct gctatgcagg aacaactcct gtgaagtgta cgttttatat gatgcgtggc      3780
     tcttcatgca gtaaataatt tctttgttaa tgtatgtttg aggggttttg aatgtcagca      3840
     tcattgaccc acaaagttat tcaagttgta aaagggtata cagtgattta actactatct      3900
     tttttattct gtcaggttac tgagctcacc ttatgaaaat ggctataaat acttagcatg      3960
     acaaattat                                                              3969
//