spacer

EBI Dbfetch

ID   AK122203; SV 1; linear; mRNA; STD; MUS; 5330 BP.
XX
AC   AK122203;
XX
DT   15-MAR-2003 (Rel. 75, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus mRNA for mKIAA0093 protein.
XX
KW   FLI_CDNA.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5330
RA   Okazaki N., Kikuno R., Nagase T., Ohara O., Koga H.;
RT   ;
RL   Submitted (07-FEB-2003) to the INSDC.
RL   Hisashi Koga, Kazusa DNA Research Institute, Laboratory for Genome
RL   Informatics; 2-6-7   Kazusa-kamatari, Kisarazu, Chiba 292-0818, Japan
RL   (E-mail:mouse@kazusa.or.jp, Tel:81-438-52-3919, Fax:81-438-52-3918)
XX
RN   [2]
RX   DOI; 10.1093/dnares/10.1.35.
RX   PUBMED; 12693553.
RA   Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S.,
RA   Nakajima D., Nagase T., Ohara O., Koga H.;
RT   "Prediction of the coding sequences of mouse homologues of KIAA gene: II.
RT   The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs
RT   identified by screening of terminal sequences of cDNA clones randomly
RT   sampled from size-fractionated libraries";
RL   DNA Res. 10(1):35-48(2003).
XX
DR   MD5; 969ae0f35be9eba99db99cad37a26a81.
DR   Ensembl-Gn; ENSMUSG00000032216; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034740; mus_musculus.
XX
CC   The CREATE program supported by Japan science and technology
CC   corporation; cDNA full insert sequencing: Kazusa DNA Research
CC   Institute; cDNA library construction, clone selection and 5'- &
CC   3'-end one pass sequencing.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5330
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone="mbg10506"
FT                   /tissue_type="brain"
FT                   /note="vector:modified pBC SK+"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..2717
FT                   /codon_start=3
FT                   /gene="mKIAA0093"
FT                   /product="mKIAA0093 protein"
FT                   /note="CDS is predicted by in silico analysis. Start codon
FT                   is not identified."
FT                   /db_xref="GOA:P46935"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="MGI:MGI:97297"
FT                   /db_xref="PDB:3M7F"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46935"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAC65485.1"
FT                   /translation="VSRSLSPLQPSRGASSSMSSDMAADESEAPVLSEDEVWEFCLDKT
FT                   EDGGGSPGSDVTDTCEPPCGCWELNPNSLEEEHVLFTADPYLELHNDDTRVVRVKVIAG
FT                   IGLAKKDILGASDPYVRVTLYDPMSGILTSVQTKTIKKSLNPKWNEEILFRVLPQRHRI
FT                   LFEVFDENRLTRDDFLGQVDVPLYPLPTENPRMERPYTFKDFVLHPRSHKSRVKGYLRL
FT                   KMTYLPKNGSEDENADQAEELEPGWVVLDQPDAATHLPHPPEPSPLPPGWEERQDVLGR
FT                   TYYVNHESRRTQWKRPSPDDDLTDEDNDDMQLQAQRAFTTRRQISEDVDGPDNRESPEN
FT                   WEIVREDENTEYSGQAVQSPPSGHIDVQTHLAEEFNTRLAVCGNPATSQPVTSSNHSSR
FT                   GGSLQTCIFEEQPTLPVLLPTSSGLPPGWEEKQDDRGRSYYVDHNSKTTTWSKPTMQDD
FT                   PRSKIPAHLRGKTDSNDLGPLPPGWEERTHTDGRVFFINHNIKKTQWEDPRLQNVAITG
FT                   PAVPYSRDYKRKYEFFRRKLKKQTDIPNKFEMKLRRANILEDSYRRIMGVKRADLLKAR
FT                   LWIEFDGEKGLDYGGVAREWFFLISKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDH
FT                   LSYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLQKLITLHDMESVDSEYYSSLRWILE
FT                   NDPTELDLRFIIDEELFGQTHQHELKTGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQM
FT                   AAFKEGFFELIPQDLIKIFDENELELLMCGLGDVDVNDWREHTKYKNGYSMNHQVIHWF
FT                   WKAVWMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQWGTPDKLPRAHTC
FT                   FNRLDLPPYESFDELWDKLQMAIENTQGFDGVD"
XX
SQ   Sequence 5330 BP; 1521 A; 1181 C; 1221 G; 1407 T; 0 other;
     cggtctctcg ctctctctcg ccgctgcagc ctagtagggg cgcttcgtcc agcatgagct        60
     cggacatggc agccgacgag tcggaggccc cagtactctc ggaggacgag gtatgggagt       120
     tttgcctgga taagacagaa gatggtggcg gatcccccgg aagtgatgtt acagacactt       180
     gtgagcctcc atgtggatgc tgggagttga atccgaattc cctggaagag gagcacgtgc       240
     tgttcactgc tgatccgtac ctggagctcc acaacgatga cacacgagtt gtgagagtga       300
     aggttatagc tggcataggc ctggccaaga aagacatctt gggagccagt gatccttacg       360
     taagagtgac attgtatgac ccgatgagtg gaatccttac cagcgtgcag acaaaaacta       420
     tcaaaaagtc tttgaatcca aaatggaatg aagaaatact gttcagggtc cttccacagc       480
     gacaccgcat tcttttcgaa gtgtttgatg aaaatcgttt gacaagagat gatttcctag       540
     gtcaagtgga tgtccctctc tatcctttac cgactgaaaa cccaagaatg gagagaccat       600
     atacatttaa ggattttgtt cttcatccaa gaagtcacaa atcaagagtt aaaggttatc       660
     tgagattaaa aatgacttat ttacctaaaa atggctcaga agatgaaaat gcagaccagg       720
     ctgaggagtt agagcctggc tgggttgttt tggaccaacc agatgctgcc actcatttgc       780
     cgcatccacc agaaccctct cccctacctc caggatggga agagaggcag gatgtccttg       840
     gaaggaccta ctacgtaaac catgaatcta gaagaacaca gtggaaaagg ccaagccctg       900
     acgatgacct cacggatgaa gacaatgatg atatgcagct gcaagcgcag cgagcattca       960
     ccaccaggcg gcagatatcg gaggatgtgg atggccctga caaccgggag tcccctgaga      1020
     attgggaaat cgtacgagaa gatgaaaaca ccgagtatag tggtcaggct gtccagtcac      1080
     ctccatcggg tcacattgat gtgcagactc accttgcaga agagtttaat accagacttg      1140
     ccgtgtgtgg aaatccagcc accagccagc cggttaccag ctcaaatcat tccagcagag      1200
     gaggcagctt gcagacctgt atctttgagg aacagcctac acttcctgtg cttttgccta      1260
     cttcatctgg attgccacca ggttgggaag aaaaacaaga tgacagagga agatcatact      1320
     atgtagacca caactctaaa accaccacat ggtccaagcc caccatgcag gatgatccaa      1380
     gatcgaaaat ccctgctcat ctgagaggaa agactgactc caatgacctg ggacccttac      1440
     ctccaggctg ggaagaaaga acccacacag atgggcgagt cttcttcata aaccacaata      1500
     taaagaagac ccagtgggaa gatcctcgcc tgcagaacgt ggcaatcact ggaccagcag      1560
     tgccctactc cagagattac aagagaaagt acgagttctt cagaaggaag ctcaagaagc      1620
     agactgacat tccaaacaaa tttgaaatga agcttcgccg cgcaaacatt ctggaggatt      1680
     cttaccggag gattatgggt gtgaagagag ctgacttgct caaggccaga ctctggattg      1740
     agtttgatgg tgaaaagggc cttgactatg gaggggttgc cagagagtgg ttcttcctca      1800
     tctcgaagga aatgttcaac ccttactacg gcctgtttga atattctgct acggataatt      1860
     acaccctaca gataaatcct aactcgggct tgtgtaatga agatcacctc tcatacttca      1920
     agttcattgg ccgtgtggct gggatggcag tttatcatgg caagctgttg gatgggtttt      1980
     tcatccgtcc gttttacaag atgatgcttc agaaactgat aacactgcac gacatggagt      2040
     ccgtggatag tgaatattac agttctctgc gatggattct tgaaaatgac ccgacggagc      2100
     tggacctgag atttatcata gatgaagaac tttttggaca gacacatcag cacgaactga      2160
     aaaccggagg atcagagatt gttgtcacca ataagaacaa aaaggagtat atctaccttg      2220
     taatacaatg gcgatttgtg aaccgtatcc agaagcaaat ggcagctttt aaagagggat      2280
     tttttgaact gataccacag gatctcatca agatatttga tgaaaatgag ctagagcttc      2340
     tcatgtgtgg tctgggagat gtggatgtga acgactggcg ggaacacaca aaatacaaaa      2400
     atggctacag catgaaccac caggtcatcc actggttctg gaaggctgtt tggatgatgg      2460
     attcggaaaa aagaatacgc ttacttcagt ttgtcactgg cacatcccgt gtgccgatga      2520
     atgggtttgc tgaactctat ggctcgaatg gaccacaatc cttcacagtg gaacaatggg      2580
     gcacccctga taagctgcca agagcacaca cctgcttcaa tcgcctggac ctgccaccct      2640
     acgaatcctt tgacgaactc tgggataaac ttcagatggc aattgagaac acacagggct      2700
     ttgatggcgt tgattagatt acaaaaaaaa acaagctgtg gtgtcttgta caccatagtt      2760
     tctaagcaaa agcaaaaaca aaatcacatt ttaacatttt ccagatagtt tctaaaagat      2820
     ggtcactggc tcttcccacc gagaccagag gacagtttat ccatgattta gccaccacca      2880
     tgctgacctg ttcacttgtc cagttacttt gtccagttgt tggggttcat gtgtacggca      2940
     ggatgtgagt cctgtacgcc tgagttctta ccctatctca tcttgctagg cacatccttc      3000
     tgaaactact gagattccaa ctgtgaaata tctgtaatga gtagctggtg ggaaaaattt      3060
     gatgcttttt aaagatgaaa tttggacaaa gaaagtcttt aatgattagt atactgcgac      3120
     atacttagta ccacatgtcg ctacttattc tgtagacctg cctagtgtac cttatcgcct      3180
     agaaccttga agccgctttg gaagatgtat cacacgtgtt tttagtcact taagtcacta      3240
     gtgtttaaaa aaaaaatgta ctcttcactt gggaagtatt tcacgtttgt tagcatgcag      3300
     cttgagcctt acaggcgatt ctggagacaa gtggagcaag cttttattgc agtgtgtagt      3360
     gagtcttagg cctccttttt gcctgtgcat cctaaggcta gagtcattat gtgttagtgc      3420
     gttagaattc cttcaaacac gaaacaagct ccacaacgca gtgtttctaa gcatgccgtg      3480
     aagaaccgag ttccatgtat gacttgccct taccagccac tcttcacgct tgcagtcacg      3540
     tagtacatac gtgtttacgg agttcattat gtttacagat taagcgaatt tctgtagttg      3600
     catttttata tttttagtat cacattagta taaaaatttg tttaaaataa ccaaagagta      3660
     gttcaatgca taatttgtat gaatttgtta ccaagtttct tatgctttct aaaaaatact      3720
     gtttcctatg aaaattatgt ttaatcaaaa gtcaagaacc cttggggcaa aatgctacag      3780
     gtggagtccc accatagtca cctttgaggc acaggaagag gttccatgca tgaatctgca      3840
     cacatgagca gtgctggctg ctgtgcaccg ggcccttggg atgaagccat cagcactgac      3900
     atccagcccc gtcttcatcc tcaggcttag aaacaagtgg gatggtgact ttacagtcag      3960
     tgggaagtaa gagcccgcag aataacaaag gcagaaggac aggaaagcga ggtccgagtc      4020
     cgactgtgag gtcatatctg ccaaggctcc ttctagtcag cttacactgg tgattatacg      4080
     gaaaatgctc ttagatatga gaaaagcaat gtggcatgta atgagttagt gtaagcttgt      4140
     gttataaact ttccgaatgc ttataagtag cctgtgggag ctgtaagaaa tacttagggc      4200
     cattgattta agcttgttgg ctctaacatg actaatacct gtcagcccat ggtagggatt      4260
     tcagtgacag tagtggaaac gctttccaca gaccacacca ctatgttgat cggtgaaaga      4320
     cacccccagg ccagtgcatg cttccagagt gtcctgatca gtcagccagg catggccacc      4380
     gtccagtgtt gatttttatc attagccagc tgagcctgca gcacggggct catttccccg      4440
     tctggcagat gtggatagct gggcccactc attctgtctc tcaaggctat ggtaagttct      4500
     taaaggggta cttttctgca agccaccaga gtctgagtca gctgtcccct cccagtaagc      4560
     atgttcacct aaagtgattt agcctaggcg aggaggatcc ctactacgtg ctggattatg      4620
     tgtgtgttca tgtaaggatt tcagcgtcaa aagttcactt cctccatagt ggcaaaataa      4680
     cactaatatg ggctggtgtg ttatctggag tgcccccatt gtgtggaact aagggtgaaa      4740
     acagaactgt acacggttgt tcagtgtcgt ccccagaact catccccagc agggcttaga      4800
     aaacacgagc ttccttcctc cttcacactc attttccttt ggatgattca gtgacatcac      4860
     agaacctggt gtccccctcc ctaccccagg tgtgtagtaa tggtccgaag ggaccctggc      4920
     tggaacacca cagcccccca tgctagtgca tgaaaacatc tcgttgatat tctaccactg      4980
     gggcattgtg gagtcacatt cacgaaacac gaagaccttg tacttctcta gaaaagtgtt      5040
     ttagcctact ttttctctaa tccccacccc aacaaatgaa acacaaaatt gcattacaaa      5100
     agcaaaccca aatggtattt gttttcgatt ttatttatac cgctcgagtt attccttata      5160
     cgtatcaagt taaactcaat tggttttaat gataagctat ttgacattgt ttttaaattt      5220
     tttcttatat ggtaaatgta tatccagatt aaggtatcga aatttattgc ataaactata      5280
     aaatcatttt caaaatttca attccacaaa taaagttcta ttctgatttt                 5330
//


spacer
spacer