spacer

EBI Dbfetch

ID   AK090116; SV 1; linear; mRNA; HTC; MUS; 4731 BP.
XX
AC   AK090116;
XX
DT   19-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 16)
XX
DE   Mus musculus colon RCB-0549 Cle-H3 cDNA, RIKEN full-length enriched
DE   library, clone:G430147P21 product:phosphatidylinositol 3-kinase, catalytic,
DE   beta polypeptide, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4731
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; b9fb266a58d8b0dca8a71189ccd6aab1.
DR   Ensembl-Gn; ENSMUSG00000032462; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035037; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=G430147P21
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4731
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="G430147P21"
FT                   /cell_line="RCB-0549 Cle-H3"
FT                   /tissue_type="colon"
FT                   /db_xref="taxon:10090"
FT   CDS             226..3420
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="phosphatidylinositol 3-kinase, catalytic, beta
FT                   polypeptide (MGD|MGI:1922019, evidence: Direct assignment)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8BTI9"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000341"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR002420"
FT                   /db_xref="InterPro:IPR003113"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:1922019"
FT                   /db_xref="PDB:2Y3A"
FT                   /db_xref="PDB:4BFR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BTI9"
FT                   /protein_id="BAC41102.1"
FT                   /translation="MPPAMADNLDIWAVDSQIASDGAISVDFLLPTGIYIQLEVPREAT
FT                   ISYIKQMLWKQVHNYPMFNLLMDIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLK
FT                   LVTRSCDPAEKLDSKIGVRIGKGLHEFDALKDPEVNEFRRKMRKFSEAKIQSLVGLSWI
FT                   DWLKHTYPPEHEPSVLENLEDKLYGGKLVVAVHFENSQDVFSFQVSPNLNPIKINELAI
FT                   QKRLTIRGKEDEASPCDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFILVECC
FT                   KIKKMYEQEMIAIEAAINRNSSNLPLPLPPKKTRVISHIWDNNNPFQITLVKGNKLNTE
FT                   ETVKVHVRAGLFHGTELLCKTVVSSEISGKNDHIWNEQLEFDINICDLPRMARLCFAVY
FT                   AVLDKVKTKKSTKTINPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRSGDVILHSWSS
FT                   FPDELEEMLNPMGTVQTNPYAENATALHITFPENKKQPCYYPPFDKIIEKAAELASGDS
FT                   ANVSSRGGKKFLAVLKEILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKW
FT                   NKLEDVAQLQALLQIWPKLPPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQ
FT                   LVQVLKYEPFLDCALSRFLLERALDNRRIGQFLFWHLRSEVHTPAVSVQFGVILEAYCR
FT                   GSVGHMKVLSKQVEALNKLKTLNSLIKLNAVKLSRAKGKEAMHTCLKQSAYREALSDLQ
FT                   SPLNPCVILSELYVEKCKYMDSKMKPLWLVYSSRAFGEDSVGVIFKNGDDLRQDMLTLQ
FT                   MLRLMDLLWKEAGLDLRMLPYGCLATGDRSGLIEVVSTSETIADIQLNSSNVAATAAFN
FT                   KDALLNWLKEYNSGDDLDRAIEEFTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHI
FT                   DFGHILGNFKSKFGIKRERVPFILTYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRR
FT                   HGNLFITLFALMLTAGLPELTSVKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWT
FT                   TKVNWMAHTVRKDYRS"
FT   polyA_signal    4703..4708
FT                   /note="putative"
FT   polyA_site      4731
FT                   /note="putative"
XX
SQ   Sequence 4731 BP; 1290 A; 1014 C; 1128 G; 1299 T; 0 other;
     cggagcgggg catgcgggtg tcggagccag gcgggcacgg ctgcgggagc tgctgacggc        60
     gctgcgggat cgggagccgg tggcggcgcg cggggcagtt catcttctaa gctgaaaaag       120
     tcttccatga ataattcaca tttaaaaatc atatattcct agaagactga aatgggggct       180
     gttattttga gggccctgag gttatgagtg tgcttccgcc ctatcatgcc tcctgctatg       240
     gcagacaacc ttgacatctg ggcagtggac tcacagattg catccgatgg cgccatatcc       300
     gtcgatttcc ttctgcccac cgggatttat atccagttgg aagtacctcg ggaagctacc       360
     atttcttata ttaaacagat gttatggaag caagttcaca actacccgat gtttaacctc       420
     ctcatggaca ttgactcgta tatgtttgca tgtgtgaatc aaactgctgt atatgaggaa       480
     ctggaagacg aaacacgaag actttgtgat gtcagacctt ttcttccagt tctcaaacta       540
     gtgactagaa gctgtgaccc cgcagaaaaa ttggactcaa aaattggggt tcgtatagga       600
     aaaggtcttc atgagtttga tgccttgaag gatcccgaag tgaatgaatt tagaagaaaa       660
     atgcgcaaat tcagtgaggc caagattcag tctctggtag ggttgtcttg gatcgactgg       720
     ctaaagcaca cgtatccgcc tgagcacgag ccgtccgtcc tggagaactt ggaagataaa       780
     ctttatggag gaaagctggt tgtggctgtg cactttgaaa atagccagga tgtatttagt       840
     tttcaagtgt ctcccaattt gaatcctata aaaataaatg aattggcaat ccagaaacgc       900
     ctcactattc gtggaaagga agatgaagct agcccctgtg actatgtgtt acaggtcagt       960
     gggagagtgg agtatgtgtt tggcgatcat ccactaattc agttccagta catccggaat      1020
     tgtgtgatga atagaaccct gccccacttc atccttgtgg aatgttgtaa gatcaagaaa      1080
     atgtatgaac aagaaatgat tgccatagag gctgccatca accgaaactc atccaacctt      1140
     cctctccctt taccaccaaa gaaaacgcga gttatttctc atatctggga caacaacaac      1200
     cctttccaaa ttaccttggt taaaggaaat aagcttaata cagaagaaac tgtgaaagtt      1260
     catgtccgag ctgggctttt tcacggaacc gagctcctgt gtaaaaccgt cgtaagctca      1320
     gagatatcag gaaagaacga ccatatttgg aatgaacaac tggaatttga tattaatatt      1380
     tgtgacttac caagaatggc tcgattatgt tttgctgttt atgcagtttt ggataaagta      1440
     aaaacgaaga aatcaacaaa gactattaat ccctctaagt atcagaccat caggaaagcc      1500
     gggaaagtgc attatcctgt cgcatgggta aataccatgg tttttgactt caaaggacag      1560
     ctgaggtctg gagacgtcat attgcatagc tggtcttcgt ttcctgatga gctggaagaa      1620
     atgctgaatc ccatggggac tgtgcagacg aacccatatg ctgagaacgc caccgccttg      1680
     cacattacgt tcccagagaa taagaagcag ccgtgttatt atcccccctt cgataagatc      1740
     attgagaagg cagctgagct tgccagcgga gacagtgcta atgtgtcaag tcgtggtgga      1800
     aaaaaatttc ttgctgtgct gaaagaaatc ttggacaggg accccctgtc tcagctgtgt      1860
     gagaacgaaa tggaccttat ttggactcta cggcaagact gccgagaaaa tttccctcag      1920
     tcactgccaa aactactctt gtcaatcaag tggaataaac ttgaagatgt tgctcagctt      1980
     caggcgctcc tgcagatatg gcccaaactg ccccccaggg aagccctgga actcctggat      2040
     ttcaactatc cagaccagta tgtccgggaa tacgctgtag gctgccttcg acagatgagt      2100
     gatgaagaac tctctcagta tcttttacaa ttggtgcaag ttttgaaata tgagcctttt      2160
     ctcgattgtg ccctctccag attcctatta gaaagagcac ttgataatcg gaggattggg      2220
     cagtttctgt tttggcatct taggtcagag gtgcacactc ctgctgtgtc cgtacagttt      2280
     ggtgtcatcc tggaagcata ctgtcgagga agcgtggggc acatgaaagt gctttccaaa      2340
     caggtggaag cactcaataa gttaaaaact ttaaatagct taatcaaact gaatgcggtg      2400
     aagctgagca gagctaaggg aaaggaggcc atgcacacgt gcctgaaaca gagtgcttac      2460
     cgggaggcgc tctctgacct gcagtcgccg ctgaacccct gcgtcatcct ctcagagctc      2520
     tatgttgaaa agtgcaaata catggactcc aagatgaagc ccctgtggct ggtctacagc      2580
     agcagagcct ttggagagga ctcggttgga gtgatcttta aaaatggtga cgatttgcgg      2640
     caggacatgc tgacgctgca gatgttgcgc ctgatggatc tgctttggaa agaagctggc      2700
     ttggacctgc ggatgctccc ctatggctgc ttagcaacag gagatcgctc tggcctcatt      2760
     gaggttgtga gcacctctga gacaatcgct gacattcagc tgaacagtag taacgtggct      2820
     gccacggcag ccttcaacaa agacgcactc ctgaactggc tcaaggagta caactctggg      2880
     gatgacctgg accgagcgat tgaggagttt accttgtcct gtgctggcta ctgtgtagcc      2940
     tcttatgtcc tcggcattgg tgacaggcac agtgacaaca tcatggtgaa gaaaaccggc      3000
     cagctcttcc acatagattt tgggcatatt cttggaaatt tcaaatctaa atttggcatt      3060
     aaaagggagc gagtaccttt tattcttact tatgacttca ttcatgtcat tcaacaagga      3120
     aaaacgggaa acactgaaaa atttggcaga ttccgccagt gctgtgaaga tgcgtatctg      3180
     attttacggc ggcatgggaa tctcttcatc accctgtttg ccctgatgtt gactgcaggg      3240
     ctgcctgagc tcacatcggt caaagatata cagtatctta aggactcgct tgccttaggg      3300
     aagagcgagg aggaagcact gaagcagttc aagcagaagt ttgacgaggc cctcagggaa      3360
     agctggacta ctaaagtgaa ctggatggct cacacagtac ggaaagacta caggtcctag      3420
     cgtccgccct actctgccgc acttgcctgt tcgtttcctt tccattttgc acttgcacta      3480
     ttgaacatga ccctgccaga aatgcaaagg gaatgaaatc ctgaagctca gagtgaagtt      3540
     caaaccacgg cgtcccgcag agcctagtct gaaccacccc atgcccaccc tgtgttcccg      3600
     agcgcttcca ggactcatcg tgagcagcag catggaggcc ccttcctgct gaccttgcac      3660
     gcgagggatg ctactaggga ctgctgggga tcttttcttt ctttccttca gtatttggta      3720
     ctttaccaga gaggtgtaca tacttctttt cagtgttgtg accaagtgct gcgactcagc      3780
     caacaactta ccacattcgg ggctgggagc tgttctaaga aagggacctc cctctccttt      3840
     ttaaattggt gagccacaaa ttacattgat tatgttgaac ttattattct tcaaagaaaa      3900
     tattttaaac ctgtgaaaac tcactaattt tgttaatatt tatcatgatg gcatcatttc      3960
     agccagactc gctgagaatc tattggtggg gcaaatataa tatatatata atatatatat      4020
     atatatatgc tgcatatata tttataaaat ttctagtggg agttctatat aaaaagatgt      4080
     ttctttggta ttcttcagcc tgtgttttca agttttacag aagcagagct tttccctaag      4140
     ttcctcttcg gttcactgta gatccagttc ttccagccgc ttcagcactg aggcgccatg      4200
     aatgcggttt ctctgtgtag ctctgagagt tcgtttcata gaacacaaca cttgagcaga      4260
     tgcatccaag gaggcgagca aatgaaaagg aatctattta tggaataaac tcgaaaccta      4320
     aatttcagta ttttagtaat atgccagctg ttcttaatgt atttattaaa atgtataaca      4380
     atgtgatttt tcaatggtat tagttcaaat tgacgtggat tcatgccaca tggaaatctt      4440
     taatttattt gttgaggtac catatagcca gggtgctagg tgatgagtgg tgttagcatg      4500
     tgcaatagga actactggtt tgctgtgtaa atggatgtca ggatccagca aaactactgc      4560
     tttcttctcc aaagacatgt gggagccttc aatcctcagt ggcatgggaa acagctgagt      4620
     acttgccccg tgacttcagt tttctatagg aattttatta aagagtgttt aattttgttg      4680
     tccttcttaa tgttctcagt caaataaatg ggtggtttca tctgtttggg g               4731
//


spacer
spacer