Dbfetch

ID   AK089885; SV 1; linear; mRNA; HTC; MUS; 1856 BP.
XX
AC   AK089885;
XX
DT   19-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus activated spleen cDNA, RIKEN full-length enriched library,
DE   clone:F830044J20 product:1-ACYL-SN-GLYCEROL-3-PHOSPHATE ACYLTRANSFERASE
DE   EPSILON (EC 2.3.1.51) (1-AGP ACYLTRANSFERASE 5) (1-AGPAT 5)
DE   (LYSOPHOSPHATIDIC ACID ACYLTRANSFERASE-EPSILON) (LPAAT-EPSILON)
DE   (1-ACYLGLYCEROL-3-PHOSPHATE O-ACYLTRANSFERASE 5) homolog [Mus musculus],
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1856
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 48a51177d23b5e2606eede981764aaa6.
DR   Ensembl-Gn; ENSMUSG00000031467; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033405; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0033386; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033316; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033386; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033099; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033898; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032421; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0033072; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033226; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0033174; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033319; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033211; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033915; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032134; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032537; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000149565; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0088283; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0088369; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0088300; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0088318; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0087882; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0088832; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0088412; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0087828; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0088027; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0087864; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0088056; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0087903; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0089122; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0087821; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0086920; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F830044J20
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1856
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F830044J20"
FT                   /tissue_type="activated spleen"
FT                   /db_xref="taxon:10090"
FT   CDS             85..1182
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="1-ACYL-SN-GLYCEROL-3-PHOSPHATE ACYLTRANSFERASE
FT                   EPSILON (EC 2.3.1.51) (1-AGP ACYLTRANSFERASE 5) (1-AGPAT 5)
FT                   (LYSOPHOSPHATIDIC ACID ACYLTRANSFERASE-EPSILON)
FT                   (LPAAT-EPSILON) (1-ACYLGLYCEROL-3-PHOSPHATE
FT                   O-ACYLTRANSFERASE 5) homolog [Mus musculus]
FT                   (SWISSPROT|Q9D1E8, evidence: FASTY, 100%ID, 100%length,
FT                   match=1062)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9D1E8"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR032098"
FT                   /db_xref="MGI:MGI:1196345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D1E8"
FT                   /protein_id="BAC40983.1"
FT                   /translation="MLLSLVLHTYSMRYLLPSVLLLGSAPTYLLAWTLWRVLSALMPAR
FT                   LYQRVDDRLYCVYQNMVLFFFENYTGVQILLYGDLPKNKENVIYLANHQSTVDWIVADM
FT                   LAARQDALGHVRYVLKDKLKWLPLYGFYFAQHGGIYVKRSAKFNDKEMRSKLQSYVNAG
FT                   TPMYLVIFPEGTRYNATYTKLLSASQAFAAQRGLAVLKHVLTPRIKATHVAFDSMKSHL
FT                   DAIYDVTVVYEGNEKGSGKYSNPPSMTEFLCKQCPKLHIHFDRIDRNEVPEEQEHMKKW
FT                   LHERFEIKDRLLIEFYDSPDPERRNKFPGKSVHSRLSVKKTLPSVLILGSLTAVMLMTE
FT                   SGRKLYMGTWLYGTLLGCLWFVIKA"
FT   regulatory      1831..1836
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1856
FT                   /note="putative"
XX
SQ   Sequence 1856 BP; 498 A; 351 C; 439 G; 568 T; 0 other;
     ggattggcgg gcggccggcg gtggctgagg tcctggtggc cgcgcgggca acgcaggcgg        60
     agtcgcggct ggcgagccga gaggatgctg ctgtccctgg tgctccacac gtactctatg       120
     cgctacctgc tccccagcgt cctgttgctg ggctcggcgc ccacctacct gctggcctgg       180
     acgctgtggc gggtgctctc cgcgctgatg cccgcccgcc tgtaccagcg cgtggacgac       240
     cggctttact gcgtctacca gaacatggtg ctcttcttct tcgagaacta caccggggtc       300
     cagatattgc tatatggaga tttgccaaaa aataaagaaa atgtaatata tctagcgaat       360
     catcaaagca cagttgactg gattgttgcg gacatgctgg ctgccagaca ggatgcccta       420
     ggacatgtgc gctacgtact gaaagacaag ttaaaatggc ttccgctgta tgggttctac       480
     tttgctcagc atggaggaat ttatgtaaaa cgaagtgcca aatttaatga taaagaaatg       540
     agaagcaagc tgcagagcta tgtgaacgca ggaacaccga tgtatcttgt gattttccca       600
     gagggaacaa ggtataatgc aacatacaca aaactccttt cagccagtca ggcatttgct       660
     gctcagcggg gccttgcagt attaaaacac gtactgacac caagaataaa ggccactcac       720
     gttgcttttg attctatgaa gagtcattta gatgcaattt atgatgtcac agtggtttat       780
     gaagggaatg agaaaggttc aggaaaatac tcaaatccac catccatgac tgagtttctc       840
     tgcaaacagt gcccaaaact tcatattcac tttgatcgta tagacagaaa tgaagttcca       900
     gaggaacaag aacacatgaa aaagtggctt catgagcgct ttgagataaa agataggttg       960
     ctcatagagt tctatgattc accagatcca gaaagaagaa acaaatttcc tgggaaaagt      1020
     gttcattcca gactaagtgt gaagaagact ttaccttcag tgttgatctt ggggagtttg      1080
     actgcggtca tgctgatgac ggagtccgga aggaaactgt acatgggcac ctggttgtat      1140
     ggaaccctcc ttggctgcct gtggtttgtt attaaagcat aagcaagtag caggctgcag      1200
     tcacagtctc ttattgatgg ctacacattg tatcacattg tttcctgaat taaataagga      1260
     gttttcttgt tgttgttttt tttgttttgt tttgttctgt tttaagcctt gatgattgaa      1320
     cactggataa agtagagttt gtgaccacag ccaacatgca tttgatttgg ggcaaacaca      1380
     tgtggctttt caggtgctgg ggttgctgga gacatggaag ctaagtggag tttatgctgt      1440
     tttttttttt ttttaatgtt ttcatgaatt aatgtccact tgtaaagatt attggatact      1500
     ttctgtaatt cagaaggttg tattttaaca ctagtttgca gtatgtttcg ctatattggt      1560
     tatcttccat ttgactactt ggcagctcag actcttaata ctaaagtatt ttacattttg      1620
     aagctatgtg atactggttt tttgttgttg ttgttgttgt taatttctga aagtcaatga      1680
     aagacactgt aatgatgcgt taagatgttc caagaaaaag gtgagaatta ttcatggcaa      1740
     aaaagatctg tctagtgtat atttttatta tattgctcta tttagctaat tttctttata      1800
     tttgcaaaat aatgaacatt tttaatattt attaaaatgc ttgatttgca cacccc          1856
//