spacer

EBI Dbfetch

ID   AK089712; SV 1; linear; mRNA; HTC; MUS; 1756 BP.
XX
AC   AK089712;
XX
DT   19-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus activated spleen cDNA, RIKEN full-length enriched library,
DE   clone:F830010E07 product:chemokine (C-C) receptor 6, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1756
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 5e6eb893ed9d2b24e9082a3c48b06903.
DR   Ensembl-Gn; ENSMUSG00000040899; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097418; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164411; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166348; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167956; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177568; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000180103; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F830010E07
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1756
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F830010E07"
FT                   /tissue_type="activated spleen"
FT                   /db_xref="taxon:10090"
FT   CDS             594..1697
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="chemokine (C-C) receptor 6 (MGD|MGI:1333797
FT                   GB|NM_009835, evidence: BLASTN, 100%, match=1163)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q542B6"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000355"
FT                   /db_xref="InterPro:IPR004067"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1333797"
FT                   /db_xref="UniProtKB/TrEMBL:Q542B6"
FT                   /protein_id="BAC40946.1"
FT                   /translation="MNSTESYFGTDDYDNTEYYSIPPDHGPCSLEEVRNFTKVFVPIAY
FT                   SLICVFGLLGNIMVVMTFAFYKKARSMTDVYLLNMAITDILFVLTLPFWAVTHATNTWV
FT                   FSDALCKLMKGTYAVNFNCGMLLLACISMDRYIAIVQATKSFRVRSRTLTHSKVICVAV
FT                   WFISIIISSPTFIFNKKYELQDRDVCEPRYRSVSEPITWKLLGMGLELFFGFFTPLLFM
FT                   VFCYLFIIKTLVQAQNSKRHRAIRVVIAVVLVFLACQIPHNMVLLVTAVNTGKVGRSCS
FT                   TEKVLAYTRNVAEVLAFLHCCLNPVLYAFIGQKFRNYFMKIMKDVWCMRRKNKMPGFLC
FT                   ARVYSESYISRQTSETVENDNASSFTM"
XX
SQ   Sequence 1756 BP; 421 A; 464 C; 425 G; 446 T; 0 other;
     ggctagagaa tacacaaggc accgcttgag agaccacggc tccgtaccat ctacagaggc        60
     cagggaacag tgaccatttg aacggaagcc atctggtgtg gactgagagc cctggaaagc       120
     tgggtaaagc atttcctggg acttgcttcc tggccaccga ggtgtgaaca acttcacagt       180
     tctaatagtc ctcacattct taggactgga gcctggataa ccactgaggc aggagtacct       240
     ggccagtcta ctttggagct cagcattttc tggggtactg tgagtgtctg ccattcaagt       300
     aagcatgaca gtgaccttct ctccgagagc tctgattgcc aatctcaccg tgctgagatc       360
     agcgttctgc agagttccag ggtgctggcc cagcacatca tagcattgtg cagagacagg       420
     ggcaacttac aaatcctggg tctttcggac ttggttcgcc actctaatca gtaggacttc       480
     acctctgctc tcccaacatc tgcactagtg agagtgtggc tgaactgccc acttcccttt       540
     ctacaccaga tctggctctc ccatccacat agagaaccac gcctgcctgg ggaatgaatt       600
     ccacagagtc ctactttgga acggatgatt atgacaacac agagtattat tctattcctc       660
     cagaccatgg gccatgctcc ctagaagagg tcagaaactt caccaaggta tttgtgccaa       720
     ttgcctactc cttaatatgt gtctttggcc tcctgggcaa cattatggtg gtgatgacct       780
     ttgccttcta caagaaagcc agatccatga ctgacgtcta cctgttgaac atggccatca       840
     cagacatact ctttgtcctc accctaccgt tctgggcagt tactcatgcc accaacactt       900
     gggttttcag cgatgcactg tgtaaactga tgaaaggcac atatgcggtc aactttaact       960
     gtgggatgct gctcctggcc tgtatcagca tggaccggta cattgccatc gtccaggcaa      1020
     ccaaatcttt ccgggtacgc tccagaacac tgacgcacag taaggtcatc tgtgtggcag      1080
     tgtggttcat ctccatcatc atctcaagcc ctacatttat cttcaacaag aaatacgagc      1140
     tgcaggatcg tgatgtctgt gagccacggt acaggtctgt ctcagagccc atcacgtgga      1200
     agctgctggg tatgggactg gagctgttct ttgggttctt cacccctttg ctgtttatgg      1260
     tgttctgcta tctgttcatt atcaagacct tggtgcaggc ccagaactcc aagaggcaca      1320
     gagccatccg agtcgtgatc gctgtggttc tcgtgttcct ggcttgtcag atccctcaca      1380
     acatggtcct cctcgtgact gcggtcaaca cgggcaaagt gggccggagc tgcagcaccg      1440
     agaaagtcct cgcctacacc aggaacgtgg ccgaggtcct ggctttcctg cattgctgcc      1500
     tcaaccccgt gttgtatgcg tttattggac agaaattcag aaactacttc atgaagatca      1560
     tgaaggatgt gtggtgtatg agaaggaaga ataagatgcc tggcttcctc tgtgcccggg      1620
     tttactcgga aagctacatc tccaggcaga ccagtgagac cgtcgaaaat gataatgcat      1680
     cgtcctttac catgtaacac gagagcacaa agcaacattg ccccaaaagc cttggtgaaa      1740
     cttgctatta catatg                                                      1756
//


spacer
spacer