spacer

EBI Dbfetch

ID   AK089270; SV 1; linear; mRNA; HTC; MUS; 2062 BP.
XX
AC   AK089270;
XX
DT   19-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length
DE   enriched library, clone:F630110B04 product:adenylate kinase 1, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2062
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 66b5c127ab287262f4bf5d833a4e3d60.
DR   Ensembl-Gn; ENSMUSG00000026817; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113277; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F630110B04
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2062
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F630110B04"
FT                   /cell_type="NOD-derived CD11c +ve dendritic cells"
FT                   /db_xref="taxon:10090"
FT   CDS             135..719
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="adenylate kinase 1 (MGD|MGI:87977 GB|NM_021515,
FT                   evidence: BLASTN, 99%, match=1921)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9R0Y5"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006267"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028582"
FT                   /db_xref="MGI:MGI:87977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R0Y5"
FT                   /protein_id="BAC40822.1"
FT                   /translation="MEEKLKKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRA
FT                   EVSSGSERGKKLSAIMEKGELVPLDTVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEE
FT                   FEQKIGQPTLLLYVDAGAETMTQRLLKRGETSGRVDDNEETIKKRLETYYNATEPVISF
FT                   YDKRGIVRKVNAEGTVDTVFSEVCTYLDSLK"
FT   regulatory      2045..2050
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2062
FT                   /note="putative"
XX
SQ   Sequence 2062 BP; 416 A; 569 C; 567 G; 510 T; 0 other;
     gatgcgtgcg cgctgacagc cttataaata gtcgcctttg caggcggctg agaggacagg        60
     cagggcactc actggcccca gcgcccacca caccctcccc cagagtgctg acctagctcc       120
     cagatctcag caggatggaa gagaagctga agaaggccaa gatcatcttt gtggtgggcg       180
     gacctggctc aggaaagggc acccagtgcg agaagattgt acagaaatat ggctacaccc       240
     acctgtctac tggggacctg cttcgggcag aagtcagctc tggatcggag aggggcaaga       300
     agctgtcggc tatcatggag aagggagagc tagtgccact ggacacggtg ctggacatgc       360
     tccgagatgc tatgttagcc aaagtggatt cttccaatgg cttcctgatc gacggctacc       420
     cgagggaggt gaaacaggga gaagaatttg aacagaagat tggacagccc acactgctgc       480
     tgtatgtgga cgcaggcgcc gagaccatga cccaacgact cctgaagcga ggggagacca       540
     gtggccgcgt ggatgacaac gaggagacca tcaagaagcg gctggagact tattacaatg       600
     ccacagaacc tgtcatctcc ttctatgaca agcgtggcat tgtgcgcaag gtcaatgccg       660
     aaggcacggt ggacactgtc ttctctgagg tctgcaccta tcttgactcc ctgaagtaac       720
     tggatccctt ggccagctcc cagcccgccc cacccttgct ccctgacccc aggcagcctg       780
     gctcaagccc agcacctcca ccctgccggg ctgtgcacag acacaggaag ccatgttatc       840
     ctgtcccatg gacactaaag aaattgccaa ggagggttag gattgctcct ttcctttgct       900
     tccagttatg gtgattcatg ctgccacagc cggaggcccc agcgtggccg gcccattctt       960
     ccctgtgcct cagcccagct gtcttgtctc cctctggctc tgctgggatc ctaggccctt      1020
     ccttagccag gctgtgtcaa agcctagggg tccctgggtt ggcaggctgc tctggggggt      1080
     ctggtgttca ccctgtttct catagcctcg ttgtgtggct ttggccctaa gccattgtct      1140
     ctctggagtg agttttcttt tttctttctt tctttttctt ttttttcttt ctctgtttct      1200
     ttcttttttt tttttttaag acagcatctc gtgtgactta agctggcctc aaccctgtta      1260
     tgtaactaag ggcaacctta atccttctgc ctccacttgt cttcctgtgt gctgagatta      1320
     caggtgtgtg tgtggacctc caccactcct ggttttgggg gcactgggaa tcaagcccat      1380
     ggccctgtat acgaggccag cacgctacag agtgagctgc atcccgggct gggcaggttt      1440
     tctgtgcctg actggggtct ggcatgggca aagggcaaag ggccatgggc tcaccagctg      1500
     gggccacgtg gtcactgggt gccaaggagc tgtgcaatgg gcatacagct aggtgggaag      1560
     ctggggtcag gggtggcctt cctgaagaag gctcccttgg tatagacctg ccaggccttg      1620
     ccatcctttg gctggtttta aagcttgtcc tgtcacgcta tgtcccaacc cttatcctcg      1680
     gcgttaagac aagagcatgc agattaagga gtgtgagctg ccatagacaa ggatgtggga      1740
     tcaaggacca ggcctgggac ccggagagga cacccaggga tgccaagaag agctggcatc      1800
     tctcttctgc tctttattct ttggtctcat tacacaggaa gcctctgttg gtactcactt      1860
     gtcctggggc cccgtctcca tccctagtga cttcccctgt aagcccagat agcctgtaag      1920
     ccagcagcca tggctgtccc agggacacct gcccctgggg gtgacggtgc tcactccttt      1980
     ctgtttacta ccagtggggc cacctttcct tctgcattgc ctatttaagc tgtcctttaa      2040
     aataaataaa tgtatttcag tt                                               2062
//


spacer
spacer