Dbfetch

ID   AK089067; SV 1; linear; mRNA; HTC; MUS; 2348 BP.
XX
AC   AK089067;
XX
DT   19-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus 2 days neonate thymus thymic cells cDNA, RIKEN full-length
DE   enriched library, clone:E430038F13 product:protein phosphatase 1, catalytic
DE   subunit, beta isoform, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2348
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 7eed79111128deb545df82e1904c9e57.
DR   Ensembl-Gn; ENSMUSG00000014956; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029435; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0029401; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0029351; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029412; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029133; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029865; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028543; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0029101; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0029250; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0029208; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0029335; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029237; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029899; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028268; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028624; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000015100; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000201360; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0070976; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0071059; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0070960; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0070984; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0070630; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071464; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071166; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0070570; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0070707; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0070617; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0070780; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0070642; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0071660; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0070636; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0069787; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=E430038F13
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2348
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /dev_stage="2 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="E430038F13"
FT                   /cell_type="thymic cells"
FT                   /tissue_type="thymus"
FT                   /db_xref="taxon:10090"
FT   CDS             206..1189
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="protein phosphatase 1, catalytic subunit, beta
FT                   isoform (MGD|MGI:104871, evidence: Direct assignment)"
FT                   /note="putative"
FT                   /db_xref="GOA:P62141"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR031675"
FT                   /db_xref="MGI:MGI:104871"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62141"
FT                   /protein_id="BAC40733.1"
FT                   /translation="MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIF
FT                   LSQPILLELEAPLKICGDNHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETIC
FT                   LLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAI
FT                   VDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGV
FT                   SFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGM
FT                   MSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR"
XX
SQ   Sequence 2348 BP; 696 A; 462 C; 547 G; 643 T; 0 other;
     gatttattta tttccagtgg gcgccgccag cgtgtgcgcg cgctgtcgct gctcggcggg        60
     gagggggtgg ggggagggcc cgcgcccggg gggagttgga gccggggtcg aaacgccgcg       120
     tgactcgtag gtgagaacgc cgagccgccg ccgccgccga gaagccctgt taacgcttta       180
     gggaggagag tctggtgccg acaagatggc ggacggggag ctgaacgtgg acagcctcat       240
     cacccgcctg ctggaggtac gaggatgtcg tccaggaaag attgtacaaa tgactgaagc       300
     agaagtccga gggttgtgta tcaagtctcg tgaaatcttt ctcagccagc ctattctttt       360
     ggaattggaa gcaccactga agatttgtgg agacaatcat ggacaatata cagacttact       420
     aagattattt gaatatggag gttttccacc agaagccaac tatcttttct taggagatta       480
     tgtggacaga ggaaagcagt ctttggaaac catctgtttg ctattggctt acaaaatcaa       540
     atacccggag aacttctttc ttctaagagg aaaccatgag tgtgctagca tcaatcgcat       600
     ttatggattc tacgatgagt gtaaacgaag atttaatatt aaattgtgga agacattcac       660
     tgattgtttt aactgtctgc ctatagctgc tattgttgat gagaaaatct tctgttgtca       720
     tggaggactg tcaccagacc tacaatctat ggaacagatt cggagaatta tgagacccac       780
     tgacgtacct gatacaggtt tgctttgtga cttactgtgg tccgacccag ataaggatgt       840
     gcaaggctgg ggagaaaatg accgtggtgt ttcttttact tttggagctg atgtagtcag       900
     taaatttctg aatcgtcatg atttagactt gatttgtcga gctcatcagg tggtggaaga       960
     cggatatgaa ttttttgcta aacgacagtt ggtaacctta ttttctgccc caaattactg      1020
     tggcgagttt gacaatgctg gtggtatgat gagtgtggat gagactttga tgtgttcatt      1080
     ccagatattg aaaccatctg aaaagaaagc taagtaccag tatggtgggc tgaattctgg      1140
     acgtcctgtc actccgcctc gaacagctaa tccaccgaag aaaaggtgaa gacaggaatt      1200
     ctagaaagag aaaccatcag atttgttaag gacatacttc ataatatata agtgtgcact      1260
     gtaaaaccat ccagccattc gacacccttt atgatgtcac acctttaact taaggagacg      1320
     atatggctac aagacaggaa catacagaga atggtgaaca gctaataaca tagttctcga      1380
     gccatacaaa cagacttcca tgttggctca attacctaac tgtctaggtg gaacctgtgg      1440
     ggaaaacaat cctcctttga atgagatttc aaatgatgct tttccccact gggctatgca      1500
     catcaccata aaccttctac tttaactcag acggatgctc acgccgatag taacatcttg      1560
     acgcacacct tcaaatgaat ttgttctaaa taatacatca agaacctaag aactcacatc      1620
     ttaagctatt tttttaaagt atattgtgaa gtacaaagca caaaaaaaag cagccatgtt      1680
     gcctgacatt tgaatagaat gtctattaaa ctaaaaagat tttttttcct ggacaagtat      1740
     agaagtgaat ttctgatctg gggtttgagc atcataaaaa ctttcttgtc tttagatctc      1800
     agttcaaaga cagaaagctg tgtctggtgt gccatggcca acagagatcc acagcagttc      1860
     ctctgtaaga aataacggaa agaaatgcat agttcactgg cagactacca gccctggaac      1920
     agtggccaca acagtgtctc ccaagtagtg ttaagtacag gatctgtaag gtaattgtgg      1980
     atctctggag agaacaattt gctacttctt aagagaatgc ctacaggtca taaagcagct      2040
     ttggaaaggt tcaaaacctg ctcatgagct ttaaagtata atgtggaagt tcaagataaa      2100
     aaggtgaagg gaaggcattc tgtggtttga cagatactta taaaactcca ttgtatctgg      2160
     ataccgaaaa atttgtgtct ttccctcaag aacaggtgtc taaccgatta ttgctaacat      2220
     tacaagaaaa cttaaaagca tctaccaaag atgcagtcat ggggaaaggc cctttcttag      2280
     tctctgcatg acatgtctca gaaagctttt ttaaaactcc atgcctttgc ctgttagaat      2340
     atcacatt                                                               2348
//