spacer

EBI Dbfetch

ID   AK088893; SV 1; linear; mRNA; HTC; MUS; 2705 BP.
XX
AC   AK088893;
XX
DT   19-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 2 days neonate thymus thymic cells cDNA, RIKEN full-length
DE   enriched library, clone:E430030E07 product:protein phosphatase 1, catalytic
DE   subunit, beta isoform, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2705
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 27d05a216428b472e698c3ba1589d18d.
DR   Ensembl-Gn; ENSMUSG00000014956; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015100; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000131300; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=E430030E07
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2705
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /dev_stage="2 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="E430030E07"
FT                   /cell_type="thymic cells"
FT                   /tissue_type="thymus"
FT                   /db_xref="taxon:10090"
FT   CDS             27..1010
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="protein phosphatase 1, catalytic subunit, beta
FT                   isoform (MGD|MGI:104871, evidence: Direct assignment)"
FT                   /note="putative"
FT                   /db_xref="GOA:P62141"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="MGI:MGI:104871"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62141"
FT                   /protein_id="BAC40636.1"
FT                   /translation="MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIF
FT                   LSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETIC
FT                   LLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAI
FT                   VDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGV
FT                   SFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGM
FT                   MSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR"
XX
SQ   Sequence 2705 BP; 779 A; 444 C; 547 G; 935 T; 0 other;
     agggaggaga gtctggtgcc gacaagatgg cggacgggga gctgaacgtg gacagcctca        60
     tcacccgcct gctggaggta cgaggatgtc gtccaggaaa gattgtacaa atgactgaag       120
     cagaagtccg agggttgtgt atcaagtctc gtgaaatctt tctcagccag cctattcttt       180
     tggaattgga agcaccactg aagatttgtg gagacattca tggacaatat acagacttac       240
     taagattatt tgaatatgga ggttttccac cagaagccaa ctatcttttc ttaggagatt       300
     atgtggacag aggaaagcag tctttggaaa ccatctgttt gctattggct tacaaaatca       360
     aatacccgga gaacttcttt cttctaagag gaaaccatga gtgtgctagc atcaatcgca       420
     tttatggatt ctacgatgag tgtaaacgaa gatttaatat taaattgtgg aagacattca       480
     ctgattgttt taactgtctg cctatagctg ctattgttga tgagaaaatc ttctgttgtc       540
     atggaggact gtcaccagac ctacaatcta tggaacagat tcggagaatt atgagaccca       600
     ctgacgtacc tgatacaggt ttgctttgtg acttactgtg gtccgaccca gataaggatg       660
     tgcaaggctg gggagaaaat gaccgtggtg tttcttttac ttttggagct gatgtagtca       720
     gtaaatttct gaatcgtcat gatttagact tgatttgtcg agctcatcag gtggtggaag       780
     acggatatga attttttgct aaacgacagt tggtaacctt attttctgcc ccaaattact       840
     gtggcgagtt tgacaatgct ggtggtatga tgagtgtgga tgagactttg atgtgttcat       900
     tccagatatt gaaaccatct gaaaagaaag ctaagtacca gtatggtggg ctgaattctg       960
     gacgtcctgt cactccgcct cgaacagcta atccaccgaa gaaaaggtga agacaggaat      1020
     tctagaaaga gaaaccatca gatttgttaa ggacatactt cataatatat aagtgtgcac      1080
     tgtaaaacca tccagccatt cgacaccctt tatgatgtca cacctttaac ttaaggagac      1140
     ggtaaaggat cttaaatttt tttctaatag aaagatgtgc tacactgtat tgtaataagt      1200
     atactctgtt ataatattca acaaaattaa atccaaattc aaaagtatcc attaaagttc      1260
     tatcttctca tatcacagtt tttaaagttg aaaagcatcc cagttaaact agccctgtta      1320
     gtgacccaga tgaaagcatg aagatccatc tgtgtaatgt ggttttagtg gtgcttggtt      1380
     gtttcattat tttgagcttg ttttgttttg tttgtttttg ctagaataat ggcatctact      1440
     tttcctattt ttccctaaac atttttaaaa gtgaaaatgg gaagagcttt aaagacattc      1500
     accaactatt cttttccttt acttatctac ttaagtaact gttggatctt actaagaaaa      1560
     cttacccctc attacagtaa aaaggaactt tagaggtcga taggttttaa aaatatacaa      1620
     actatctgat ccattgattt taatcaaaca gtttgactgg gcaaactttg cagctgataa      1680
     tgagtatttc gctttttaca aaattgccac tgatttggat ttgtgcactc taatctttaa      1740
     tttattgatg ctctattgtg cagtagcatt tcatttaaga taaggctcat atagtaatat      1800
     ccaaaactag ttggtaatgt gattatgtgg tactttggct ttgggttcta attcgcacga      1860
     aacacctttt ggcatgctta actttctggt attaccctca cctgcattgg ttttgttttt      1920
     tggggttttt gttgtttgtt tgtttttaga ttcacagaac atgagaatcc tttttgacaa      1980
     gccttggata gctggctctc ttctttccct ctctctatgt gaaggatgta tttaaatgaa      2040
     cgctggtcag tgggacattt gtcagctctg aatattgggt gcttcactaa taattgccat      2100
     gtgaatgttg ttttgactgt aaggctatgt cactaaagat ttttactctg cgttttcata      2160
     atcaaaggtc atgatgtgta tagacatgct ttgtagtgaa gtatagtagc aataatttct      2220
     gtatgtgatc aagagtttat tgcattattt ctttccctgt tctctttttt tttttttaag      2280
     ggttagcatt aacaaatgtc aaggagtagc aaagtcaaca aagattttag aaggaggagg      2340
     aactaagagc atacacagac ttatgattct ttggatgtga cacttattgg atgtgattct      2400
     aaagtctttt attgaacatt gtcaaattcg tacgcttcat aggatggaca taatgtttat      2460
     ataatgccct tcttatgtgt taccatagat gtgtgaaacc ttatagcgtc cttgaaagtg      2520
     ttaaattgag aactctgtta acattttatg gattgacaca ttatattact gcaagtaaca      2580
     tttgattttc agcacagtgc aaaagttctt taaaatgcat atgtcttttt ttttctaatt      2640
     ccattttgtt taaagcacat tttaaatgta gttttctcat ttagtaaaag ttgtctaatt      2700
     gatgc                                                                  2705
//


spacer
spacer