Dbfetch

ID   AK088859; SV 1; linear; mRNA; HTC; MUS; 1403 BP.
XX
AC   AK088859;
XX
DT   19-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 2 days neonate thymus thymic cells cDNA, RIKEN full-length
DE   enriched library, clone:E430029E06 product:N-acetylneuraminate pyruvate
DE   lyase, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1403
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 1eb8d461213d0c1aecf45554073b38ee.
DR   Ensembl-Gn; ENSMUSG00000042684; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016598; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0016580; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0016545; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016540; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0016365; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017001; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015944; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0016339; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0016445; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0016443; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0016516; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016469; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017037; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015730; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016007; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000041874; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0022684; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0022657; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0022624; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0022624; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0022435; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0023140; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0021968; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0022377; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0022501; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0022509; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0022603; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0022476; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0023176; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0021687; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0022002; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=E430029E06
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1403
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /dev_stage="2 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="E430029E06"
FT                   /cell_type="thymic cells"
FT                   /tissue_type="thymus"
FT                   /db_xref="taxon:10090"
FT   CDS             86..1048
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="N-acetylneuraminate pyruvate lyase (MGD|MGI:1921341
FT                   GB|AK002734, evidence: BLASTN, 99%, match=1401)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9DCJ9"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="MGI:MGI:1921341"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9DCJ9"
FT                   /protein_id="BAC40618.1"
FT                   /translation="MAFPKKKLRGLVAATITPMTENGEINFPVIGQYVDYLVKEQGVKN
FT                   IFVNGTTGEGLSLSVSERRQVAEEWVNQGRNKLDQVVIHVGALNVKESQELAQHAAEIG
FT                   ADGIAVIAPFFFKSQNKDALISFLREVAAAAPTLPFYYYHMPSMTGVKIRAEELLDGIQ
FT                   DKIPTFQGLKFTDTDLLDFGQCVDQNHQRQFALLFGVDEQLLSALVMGATGAVGSTYNY
FT                   LGKKTNQMLEAFEQKDLASALSYQFRIQRFINYVIKLGFGVSQTKAIMTLVSGIPMGPP
FT                   RLPLQKATQEFTAKAEAKLKSLDFLSSPSVKEGKPLASA"
FT   regulatory      1381..1386
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1403
FT                   /note="putative"
XX
SQ   Sequence 1403 BP; 387 A; 304 C; 337 G; 375 T; 0 other;
     ggagatcgcg tttccagtgc ccagcagccg aggtgagcgc ggcgccaccg agcagaggag        60
     tgaagtcaga ccttccagca gcccgatggc cttccctaag aagaaactcc ggggtcttgt       120
     tgctgccacc atcactccaa tgacagagaa tggagaaatc aactttcctg tcattggtca       180
     gtatgtggat tacctggtga aggaacaggg ggtgaagaat atttttgtga atggcaccac       240
     aggagaaggc ctgtccctga gcgtctctga acgtcgccag gtcgcggagg aatgggttaa       300
     ccaagggagg aacaagttgg accaggtggt gattcacgtg ggagcactaa acgtgaagga       360
     gtcacaagaa ctggcccaac atgcagcaga aattggagct gatggcattg ctgtcattgc       420
     gcctttcttt ttcaagtcac agaacaaaga tgccctgata agcttcctga gggaggtggc       480
     agctgcagcc cctactttgc cattttatta ctaccacatg ccttccatga ccggggtaaa       540
     gattcgcgct gaggagctgc tggacgggat tcaggacaag atccccacct tccaaggact       600
     gaagttcacc gacacggacc tcttggattt cggccaatgt gtcgatcaga atcaccagcg       660
     acagtttgct ttgctctttg gggtggacga acaactgttg agtgctctgg tcatgggagc       720
     cactggagca gtaggcagta cctataacta cctgggaaaa aagacaaacc agatgttgga       780
     ggcttttgaa cagaaggact tggcttcagc actcagttac cagtttcgta tccagagatt       840
     tatcaactat gtgatcaagc taggttttgg agtgtcgcaa accaaagcca tcatgacgct       900
     ggtctctggg attccaatgg gcccaccccg gcttcctctg cagaaagcca cccaggagtt       960
     tactgctaag gctgaggcca agctaaagag cctggatttc ctttcttccc ctagtgtaaa      1020
     ggaggggaag cctttagcta gtgcctgata agtctgggtg tgtaagctta gacttatcta      1080
     tcttcaatag tacattcttt tctcagggac ttttttaggt gaatttgaac ccatctttat      1140
     tttaggaagt agaatcccac accaatcaaa tattgattat gaaactaaac ttttttgtta      1200
     taaaggagtc acaagcccta agtcattcat tttgtaaaat tattatagag aaatctctac      1260
     ttatacagat gcaatggaac caagtgaaaa ttgtaatagt aattacaatt attaattaat      1320
     tacattaatt aatataattc atattactat attaattgct acttggttat attattgctg      1380
     aataaatttc acctgccttt tgg                                              1403
//