spacer

EBI Dbfetch

ID   AK088793; SV 1; linear; mRNA; HTC; MUS; 1085 BP.
XX
AC   AK088793;
XX
DT   19-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 2 days neonate thymus thymic cells cDNA, RIKEN full-length
DE   enriched library, clone:E430026B17 product:cofilin 1, non-muscle, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1085
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 6817636534e91094831a049914944eb6.
DR   Ensembl-Gn; ENSMUSG00000056201; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116560; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=E430026B17
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1085
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /dev_stage="2 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="E430026B17"
FT                   /cell_type="thymic cells"
FT                   /tissue_type="thymus"
FT                   /db_xref="taxon:10090"
FT   CDS             81..581
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="cofilin 1, non-muscle (MGD|MGI:101757 GB|NM_007687,
FT                   evidence: BLASTN, 99%, match=1084)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q544Y7"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="InterPro:IPR017904"
FT                   /db_xref="InterPro:IPR027234"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="MGI:MGI:101757"
FT                   /db_xref="UniProtKB/TrEMBL:Q544Y7"
FT                   /protein_id="BAC40575.1"
FT                   /translation="MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKK
FT                   NIILEEGKEILVGDVGQTVDDPYTTFVKMLPDKDCRYALYDATYETKESKKEDLVFIFW
FT                   APENAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEG
FT                   KPL"
XX
SQ   Sequence 1085 BP; 246 A; 313 C; 273 G; 253 T; 0 other;
     ggttcagtcg gatcccggca gcagctgcgg cggctcaggt cttcagttgc tctttctgtc        60
     tccctttcgt ttccggaaac atggcctctg gtgtggctgt ctctgatggt gtcatcaagg       120
     tgttcaatga catgaaggtt cgcaagtctt caacaccaga agaagtgaag aaacgcaaga       180
     aggcggtgct cttttgcctg agtgaggaca agaagaacat catcctggag gagggcaagg       240
     agatcctggt aggagatgtg gggcagactg tggacgaccc ctacaccact tttgtcaaga       300
     tgctgccaga caaggactgc cgctatgcac tctatgatgc aacctatgag accaaggaga       360
     gcaagaagga ggacctggtg ttcatcttct gggcccccga gaatgcaccc ctcaagagca       420
     aaatgatcta tgccagctcc aaggatgcca tcaagaagaa gctgacagga atcaagcatg       480
     aattacaagc taactgctac gaggaggtca aggaccgctg caccctggca gagaaactag       540
     gtggcagcgc cgtcatttcc ctggagggca agcctttgtg agccacctcc agccccctgc       600
     ctggagcatc ttaacagccc cagacctgct cttgggtgtt gcaggctgcc cctttcctgc       660
     cagaccggag gggctggggg gatcccagca gggggagggc tatcccttca ccccagttgc       720
     caaacatccc tcccacaccc tggaccgtcc ttctccctcc atccctgacg gttctggcct       780
     tcccaaactg cttttgatct tctgattcct cttgggttga cgcagaccaa gtcccgtcct       840
     aggcacccag tttgggggga gcctgtattt ttttttttaa cgacacccct actccgtatc       900
     cctccccatc ccatgctgcc aacttctaac cacaatagtg actctgtgct tgtctgttta       960
     gttctgtgtg taaatgaaat gtggaaatga ccctccctgc cccagctggc tgccctcccc      1020
     tttcctttga tcttgaccac tcatggaagc aggaccagta agggaccttc aatttaaaac      1080
     aaaac                                                                  1085
//


spacer
spacer