spacer

EBI Dbfetch

ID   AK088767; SV 1; linear; mRNA; HTC; MUS; 2790 BP.
XX
AC   AK088767;
XX
DT   19-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus 2 days neonate thymus thymic cells cDNA, RIKEN full-length
DE   enriched library, clone:E430025J12 product:neural precursor cell expressed,
DE   developmentally down-regulated gene 4a, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2790
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 2c227b4f7374583d713c46a22354b067.
DR   Ensembl-Gn; ENSMUSG00000032216; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034740; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=E430025J12
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2790
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /dev_stage="2 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="E430025J12"
FT                   /cell_type="thymic cells"
FT                   /tissue_type="thymus"
FT                   /db_xref="taxon:10090"
FT   CDS             124..2787
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="neural precursor cell expressed, developmentally
FT                   down-regulated gene 4a (MGD|MGI:97297 GB|NM_010890,
FT                   evidence: BLASTN, 99%, match=2334)"
FT                   /note="putative"
FT                   /db_xref="GOA:P46935"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR024928"
FT                   /db_xref="MGI:MGI:97297"
FT                   /db_xref="PDB:3M7F"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46935"
FT                   /protein_id="BAC40558.1"
FT                   /translation="MSSDMAADESEAPVLSEDEVWEFCLDKTEDGGGSPGSDVTDTCEP
FT                   PCGCWELNPNSLEEEHVLFTADPYLELHNDDTRVVRVKVIAGIGLAKKDILGASDPYVR
FT                   VTLYDPMSGILTSVQTKTIKKSLNPKWNEEILFRVLPQRHRILFEVFDENRLTRDDFLG
FT                   QVDVPLYPLPTENPRMERPYTFKDFVLHPRSHKSRVKGYLRLKMTYLPKNGSEDENADQ
FT                   AEELEPGWVVLDQPDAATHLPHPPEPSPLPPGWEERQDVLGRTYYVNHESRRTQWKRPS
FT                   PDDDLTDEDNDDMQLQAQRAFTTRRQISEDVDGPDNRESPENWEIVREDENTEYSGQAV
FT                   QSPPSGHIDVQTHLAEEFNTRLAVCGNPATSQPVTSSNHSSRGGSLQTCIFEEQPTLPV
FT                   LLPTSSGLPPGWEEKQDDRGRSYYVDHNSKTTTWSKPTMQDDPRSKIPAHLRGKTDSND
FT                   LGPLPPGWEERTHTDGRVFFINHNIKKTQWEDPRLQNVAITGPAVPYSRDYKRKYEFFR
FT                   RKLKKQTDIPNKFEMKLRRANILEDSYRRIMGVKRADLLKARLWIEFDGEKGLDYGGVA
FT                   REWFFLISKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYH
FT                   GKLLDGFFIRPFYKMMLQKLITLHDMESVDSEYYSSLRWILENDPTELDLRFIIDEELF
FT                   GQTHQHELKTGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIK
FT                   IFDENELELLMCGLGDVDVNDWREHTKYKNGYSMNHQVIHWFWKAVWMMDSEKRIRLLQ
FT                   FVTGTSRVPMNGFAELYGSNGPQSFTVEQWGTPDKLPRAHTCFNRLDLPPYESFDELWD
FT                   KLQMAIENTQGFDGVD"
XX
SQ   Sequence 2790 BP; 796 A; 651 C; 694 G; 649 T; 0 other;
     ggcgctgccc ggagtgggcc tcctccgccg cagcgacgcc tcctcctcct cttcctctct        60
     ccttctctct cggtctctcg ctctctctcg ccgctgcagc ctagtagggg cgcttcgtcc       120
     agcatgagct cggacatggc agccgacgag tcggaggccc cagtactctc ggaggacgag       180
     gtatgggagt tttgcctgga taagacagaa gatggtggcg gatcccccgg aagtgatgtt       240
     acagacactt gtgagcctcc atgtggatgc tgggagttga atccgaattc cctggaagag       300
     gagcacgtgc tgttcactgc tgatccgtac ctggagctcc acaacgatga cacacgagtt       360
     gtgagagtga aggttatagc tggcataggc ctggccaaga aagacatctt gggagccagt       420
     gatccttacg taagagtgac attgtatgac ccgatgagtg gaatccttac cagcgtgcag       480
     acaaaaacta tcaaaaagtc tttgaatcca aaatggaatg aagaaatact gttcagggtc       540
     cttccacagc gacaccgcat tcttttcgaa gtgtttgatg aaaatcgttt gacaagagat       600
     gatttcctag gtcaagtgga tgtccctctc tatcctttac cgactgaaaa cccaagaatg       660
     gagagaccat atacatttaa ggattttgtt cttcatccaa gaagtcacaa atcaagagtt       720
     aaaggttatc tgagattaaa aatgacttat ttacctaaaa atggctcaga agatgaaaat       780
     gcagaccagg ctgaggagtt agagcctggc tgggttgttt tggaccaacc agatgctgcc       840
     actcatttgc cgcatccacc agaaccctct cccctacctc caggatggga agagaggcag       900
     gatgtccttg gaaggaccta ctacgtaaac catgaatcta gaagaacaca gtggaaaagg       960
     ccaagccctg acgatgacct cacggatgaa gacaatgatg atatgcagct gcaagcgcag      1020
     cgagcattca ccaccaggcg gcagatatcg gaggatgtgg atggccctga caaccgggag      1080
     tcccctgaga attgggaaat cgtacgagaa gatgaaaaca ccgagtatag tggtcaggct      1140
     gtccagtcac ctccatcggg tcacattgat gtgcagactc accttgcaga agagtttaat      1200
     accagacttg ccgtgtgtgg aaatccagcc accagccagc cggttaccag ctcaaatcat      1260
     tccagcagag gaggcagctt gcagacctgt atctttgagg aacagcctac acttcctgtg      1320
     cttttgccta cttcatctgg attgccacca ggttgggaag aaaaacaaga tgacagagga      1380
     agatcatact atgtagacca caactctaaa accaccacat ggtccaagcc caccatgcag      1440
     gatgatccaa gatcgaaaat ccctgctcat ctgagaggaa agactgactc caatgacctg      1500
     ggacccttac ctccaggctg ggaagaaaga acccacacag atgggcgagt cttcttcata      1560
     aaccacaata taaagaagac ccagtgggaa gatcctcgcc tgcagaacgt ggcaatcact      1620
     ggaccagcag tgccctactc cagagattac aagagaaagt acgagttctt cagaaggaag      1680
     ctcaagaagc agactgacat tccaaacaaa tttgaaatga agcttcgccg cgcaaacatt      1740
     ctggaggatt cttaccggag gattatgggt gtgaagagag ctgacttgct caaggccaga      1800
     ctctggattg agtttgatgg tgaaaagggc cttgactatg gaggggttgc cagagagtgg      1860
     ttcttcctca tctcgaagga aatgttcaac ccttactacg gcctgtttga atattctgct      1920
     acggataatt acaccctaca gataaatcct aactcgggct tgtgtaatga agatcacctc      1980
     tcatacttca agttcattgg ccgtgtggct gggatggcag tttatcatgg caagctgttg      2040
     gatgggtttt tcatccgtcc gttttacaag atgatgcttc agaaactgat aacactgcac      2100
     gacatggagt ccgtggatag tgaatattac agttctctgc gatggattct tgaaaatgac      2160
     ccgacggagc tggacctgag atttatcata gatgaagaac tttttggaca gacacatcag      2220
     cacgaactga aaaccggagg atcagagatt gttgtcacca ataagaacaa aaaggagtat      2280
     atctaccttg taatacaatg gcgatttgtg aaccgtatcc agaagcaaat ggcagctttt      2340
     aaagagggat tttttgaact gataccacag gatctcatca agatatttga tgaaaatgag      2400
     ctagagcttc tcatgtgtgg tctgggagat gtggatgtga acgactggcg ggaacacaca      2460
     aaatacaaaa atggctacag catgaaccac caggtcatcc actggttctg gaaggctgtt      2520
     tggatgatgg attcggaaaa aagaatacgc ttacttcagt ttgtcactgg cacatcccgt      2580
     gtgccgatga atgggtttgc tgaactctat ggctcgaatg gaccacaatc cttcacagtg      2640
     gaacaatggg gcacccctga taagctgcca agagcacaca cctgcttcaa tcgcctggac      2700
     ctgccaccct acgaatcctt tgacgaactc tgggataaac ttcagatggc aattgagaac      2760
     acacagggct ttgatggcgt tgattagatt                                       2790
//


spacer
spacer