spacer

EBI Dbfetch

ID   AK088633; SV 1; linear; mRNA; HTC; MUS; 1122 BP.
XX
AC   AK088633;
XX
DT   19-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 2 days neonate thymus thymic cells cDNA, RIKEN full-length
DE   enriched library, clone:E430021O19 product:cofilin 1, non-muscle, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1122
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 6d1f436f0e8e57d11750fd406d069882.
DR   Ensembl-Gn; ENSMUSG00000056201; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116560; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=E430021O19
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1122
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /dev_stage="2 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="E430021O19"
FT                   /cell_type="thymic cells"
FT                   /tissue_type="thymus"
FT                   /db_xref="taxon:10090"
FT   CDS             82..582
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="cofilin 1, non-muscle (MGD|MGI:101757 GB|NM_007687,
FT                   evidence: BLASTN, 99%, match=1119)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q544Y7"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="InterPro:IPR017904"
FT                   /db_xref="InterPro:IPR027234"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="MGI:MGI:101757"
FT                   /db_xref="UniProtKB/TrEMBL:Q544Y7"
FT                   /protein_id="BAC40467.1"
FT                   /translation="MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKK
FT                   NIILEEGKEILVGDVGQTVDDPYTTFVKMLPDKDCRYALYDATYETKESKKEDLVFIFW
FT                   APENAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEG
FT                   KPL"
FT   polyA_signal    1100..1105
FT                   /note="putative"
FT   polyA_site      1122
FT                   /note="putative"
XX
SQ   Sequence 1122 BP; 271 A; 318 C; 274 G; 259 T; 0 other;
     cggttcagtc ggatcccggc agcagctgcg gcggctcagg tcttcagttg ctctttctgt        60
     ctccctttcg tttccggaaa catggcctct ggtgtggctg tctctgatgg tgtcatcaag       120
     gtgttcaatg acatgaaggt tcgcaagtct tcaacaccag aagaagtgaa gaaacgcaag       180
     aaggcggtgc tcttttgcct gagtgaggac aagaagaaca tcatcctgga ggagggcaag       240
     gagatcctgg taggagatgt ggggcagact gtggacgacc cctacaccac ttttgtcaag       300
     atgctgccag acaaggactg ccgctatgca ctctatgatg caacctatga gaccaaggag       360
     agcaagaagg aggacctggt gttcatcttc tgggcccccg agaatgcacc cctcaagagc       420
     aaaatgatct atgccagctc caaggatgcc atcaagaaga agctgacagg aatcaagcat       480
     gaattacaag ctaactgcta cgaggaggtc aaggaccgct gcaccctggc agaaaaacta       540
     ggtggcagcg ccgtcatttc cttggagggc aagcctttgt gagccacctc cagccccctg       600
     cttggagcat cttaacagcc ccaaacctgc tcttgggtgt tgcaggctgc ccctttcctg       660
     ccagaccgga ggggctgggg ggatcccagc agggggaggg ctatcccttc accccagttg       720
     ccaaacatcc ctcccacccc ctggaccgtc cttctccctc catccctgac ggttctggcc       780
     ttcccaaact gcttttgatc ttctgattcc tcttgggttg acgcagacca agtcccgtcc       840
     taggcaccca gtttgggggg agcctgtatt ttttttttta acgacacccc tactccgtat       900
     ccctccccat cccatgctgc caacttctaa ccacaatagt gactctgtgc ttgtctgttt       960
     agttctgtgt gtaaatgaaa tgtggaaatg accctccctg ccccagctgg ctgccctccc      1020
     ctttcctttg atcttgacca ctcatggaag caggaccagt aagggacctt caatttaaaa      1080
     caaaacaaaa caaaaaaaca ataaaaaggc taattaacaa cg                         1122
//


spacer
spacer