spacer

EBI Dbfetch

ID   AK088620; SV 1; linear; mRNA; HTC; MUS; 3703 BP.
XX
AC   AK088620;
XX
DT   19-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus 2 days neonate thymus thymic cells cDNA, RIKEN full-length
DE   enriched library, clone:E430021K23 product:neural precursor cell expressed,
DE   developmentally down-regulated gene 4a, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3703
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; d3a9ef6202478ccb9b08f941d01bfa43.
DR   Ensembl-Gn; ENSMUSG00000032216; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034740; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=E430021K23
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3703
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /dev_stage="2 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="E430021K23"
FT                   /cell_type="thymic cells"
FT                   /tissue_type="thymus"
FT                   /db_xref="taxon:10090"
FT   CDS             115..2778
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="neural precursor cell expressed, developmentally
FT                   down-regulated gene 4a (MGD|MGI:97297 GB|NM_010890,
FT                   evidence: BLASTN, 99%, match=2334)"
FT                   /note="putative"
FT                   /db_xref="GOA:P46935"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR024928"
FT                   /db_xref="MGI:MGI:97297"
FT                   /db_xref="PDB:3M7F"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46935"
FT                   /protein_id="BAC40458.1"
FT                   /translation="MSSDMAADESEAPVLSEDEVWEFCLDKTEDGGGSPGSDVTDTCEP
FT                   PCGCWELNPNSLEEEHVLFTADPYLELHNDDTRVVRVKVIAGIGLAKKDILGASDPYVR
FT                   VTLYDPMSGILTSVQTKTIKKSLNPKWNEEILFRVLPQRHRILFEVFDENRLTRDDFLG
FT                   QVDVPLYPLPTENPRMERPYTFKDFVLHPRSHKSRVKGYLRLKMTYLPKNGSEDENADQ
FT                   AEELEPGWVVLDQPDAATHLPHPPEPSPLPPGWEERQDVLGRTYYVNHESRRTQWKRPS
FT                   PDDDLTDEDNDDMQLQAQRAFTTRRQISEDVDGPDNRESPENWEIVREDENTEYSGQAV
FT                   QSPPSGHIDVQTHLAEEFNTRLAVCGNPATSQPVTSSNHSSRGGSLQTCIFEEQPTLPV
FT                   LLPTSSGLPPGWEEKQDDRGRSYYVDHNSKTTTWSKPTMQDDPRSKIPAHLRGKTDSND
FT                   LGPLPPGWEERTHTDGRVFFINHNIKKTQWEDPRLQNVAITGPAVPYSRDYKRKYEFFR
FT                   RKLKKQTDIPNKFEMKLRRANILEDSYRRIMGVKRADLLKARLWIEFDGEKGLDYGGVA
FT                   REWFFLISKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYH
FT                   GKLLDGFFIRPFYKMMLQKLITLHDMESVDSEYYSSLRWILENDPTELDLRFIIDEELF
FT                   GQTHQHELKTGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIK
FT                   IFDENELELLMCGLGDVDVNDWREHTKYKNGYSMNHQVIHWFWKAVWMMDSEKRIRLLQ
FT                   FVTGTSRVPMNGFAELYGSNGPQSFTVEQWGTPDKLPRAHTCFNRLDLPPYESFDELWD
FT                   KLQMAIENTQGFDGVD"
XX
SQ   Sequence 3703 BP; 1051 A; 833 C; 873 G; 946 T; 0 other;
     gggagtgggc ctcctccgcc gcagcgacgc ctcctcctcc tcttcctctc tccttctctc        60
     tcggtctctc gctctctctc gccgctgcag cctagtaggg gcgcttcgtc cagcatgagc       120
     tcggacatgg cagccgacga gtcggaggcc ccagtactct cggaggacga ggtatgggag       180
     ttttgcctgg ataagacaga agatggtggc ggatcccccg gaagtgatgt tacagacact       240
     tgtgagcctc catgtggatg ctgggagttg aatccgaatt ccctggaaga ggagcacgtg       300
     ctgttcactg ctgatccgta cctggagctc cacaacgatg acacacgagt tgtgagagtg       360
     aaggttatag ctggcatagg cctggccaag aaagacatct tgggagccag tgatccttac       420
     gtaagagtga cattgtatga cccgatgagt ggaatcctta ccagcgtgca gacaaaaact       480
     atcaaaaagt ctttgaatcc aaaatggaat gaagaaatac tgttcagggt ccttccacag       540
     cgacaccgca ttcttttcga agtgtttgat gaaaatcgtt tgacaagaga tgatttccta       600
     ggtcaagtgg atgtccctct ctatccttta ccgactgaaa acccaagaat ggagagacca       660
     tatacattta aggattttgt tcttcatcca agaagtcaca aatcaagagt taaaggttat       720
     ctgagattaa aaatgactta tttacctaaa aatggctcag aagatgaaaa tgcagaccag       780
     gctgaggagt tagagcctgg ctgggttgtt ttggaccaac cagatgctgc cactcatttg       840
     ccgcatccac cagaaccctc tcccctacct ccaggatggg aagagaggca ggatgtcctt       900
     ggaaggacct actacgtaaa ccatgaatct agaagaacac agtggaaaag gccaagccct       960
     gacgatgacc tcacggatga agacaatgat gatatgcagc tgcaagcgca gcgagcattc      1020
     accaccaggc ggcagatatc ggaggatgtg gatggccctg acaaccggga gtcccctgag      1080
     aattgggaaa tcgtacgaga agatgaaaac accgagtata gtggtcaggc tgtccagtca      1140
     cctccatcgg gtcacattga tgtgcagact caccttgcag aagagtttaa taccagactt      1200
     gccgtgtgtg gaaatccagc caccagccag ccggttacca gctcaaatca ttccagcaga      1260
     ggaggcagct tgcagacctg tatctttgag gaacagccta cacttcctgt gcttttgcct      1320
     acttcatctg gattgccacc aggttgggaa gaaaaacaag atgacagagg aagatcatac      1380
     tatgtagacc acaactctaa aaccaccaca tggtccaagc ccaccatgca ggatgatcca      1440
     agatcgaaaa tccctgctca tctgagagga aagactgact ccaatgacct gggaccctta      1500
     cctccaggct gggaagaaag aacccacaca gatgggcgag tcttcttcat aaaccacaat      1560
     ataaagaaga cccagtggga agatcctcgc ctgcagaacg tggcaatcac tggaccagca      1620
     gtgccctact ccagagatta caagagaaag tacgagttct tcagaaggaa gctcaagaag      1680
     cagactgaca ttccaaacaa atttgaaatg aagcttcgcc gcgcaaacat tctggaggat      1740
     tcttaccgga ggattatggg tgtgaagaga gctgacttgc tcaaggccag actctggatt      1800
     gagtttgatg gtgaaaaggg ccttgactat ggaggggttg ccagagagtg gttcttcctc      1860
     atctcgaagg aaatgttcaa cccttactac ggcctgtttg aatattctgc tacggataat      1920
     tacaccctac agataaatcc taactcgggc ttgtgtaatg aagatcacct ctcatacttc      1980
     aagttcattg gccgtgtggc tgggatggca gtttatcatg gcaagctgtt ggatgggttt      2040
     ttcatccgtc cgttttacaa gatgatgctt cagaaactga taacactgca cgacatggag      2100
     tccgtggata gtgaatatta cagttctctg cgatggattc ttgaaaatga cccgacggag      2160
     ctggacctga gatttatcat agatgaagaa ctttttggac agacacatca gcacgaactg      2220
     aaaaccggag gatcagagat tgttgtcacc aataagaaca aaaaggagta tatctacctt      2280
     gtaatacaat ggcgatttgt gaaccgtatc cagaagcaaa tggcagcttt taaagaggga      2340
     ttttttgaac tgataccaca ggatctcatc aagatatttg atgaaaatga gctagagctt      2400
     ctcatgtgtg gtctgggaga tgtggatgtg aacgactggc gggaacacac aaaatacaaa      2460
     aatggctaca gcatgaacca ccaggtcatc cactggttct ggaaggctgt ttggatgatg      2520
     gattcggaaa aaagaatacg cttacttcag tttgtcactg gcacatcccg tgtgccgatg      2580
     aatgggtttg ctgaactcta tggctcgaat ggaccacaat ccttcacagt ggaacaatgg      2640
     ggcacccctg ataagctgcc aagagcacac acctgcttca atcgcctgga cctgccaccc      2700
     tacgaatcct ttgacgaact ctgggataaa cttcagatgg caattgagaa cacacagggc      2760
     tttgatggcg ttgattagat tacaaaaaaa aacaagctgt ggtgtcttgt acaccatagt      2820
     ttctaagcaa agcaaaaaca aaatcacatt ttaacatttt ccagatagtt tctaaaagat      2880
     ggtcactggc tcttcccacc gagaccagag gacagtttat ccatgattta gccaccacca      2940
     tgctgacctg ttcacttgtc cagttacttt gtccagttgt tggggttcat gtgtacggca      3000
     ggatgtgagt cctgtacgcc tgagttctta ccctatctca tcttgctagg cacatccttc      3060
     tgaaactact gagattccaa ctgtgaaata tctgtaatga gtagctggtg ggaaaaattt      3120
     gatgcttttt aaagatgaaa tttggacaaa gaaagtcttt aatgattagt atactgcgac      3180
     atacttagta ccacatgtcg ctacttattc tgtagacctg cctagtgtac cttatcgcct      3240
     agaaccttga agccgctttg gaagatgtat cacacgtgtt tttagtcact taagtcacta      3300
     gtgtttaaaa aaaaaatgta ctcttcactt gggaagtatt tcacgtttgt tagcatgcag      3360
     cttgagcctt acaggcgatt ctggagacaa gtggagcaag cttttattgc agtgtgtagt      3420
     gagtcttagg cctccttttt gcctgtgcat cctaaggcta gagtcattat gtgttagtgc      3480
     gttagaattc cttcaaacac gaaacaagct ccacaacgca gtgtttctaa gcatgccgtg      3540
     aagaaccgag ttccatgtat gacttgccct taccagccac tcttcacgct tgcagtcacg      3600
     tagtacatac gtgtttacgg agttcattat gtttacagat taagcgaatt tctgtagttg      3660
     catttttata tttttagtat cacattagta taaaaatttg ttt                        3703
//


spacer
spacer