Dbfetch

ID   AK088407; SV 1; linear; mRNA; HTC; MUS; 1903 BP.
XX
AC   AK088407;
XX
DT   19-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 2 days neonate thymus thymic cells cDNA, RIKEN full-length
DE   enriched library, clone:E430016A01 product:UDP-Gal:betaGlcNAc beta
DE   1,3-galactosyltransferase, polypeptide 3, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1903
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; b4ae13d4bd7892c9d88bf6c2fe3a0778.
DR   Ensembl-Gn; ENSMUSG00000043300; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027296; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0027258; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0027226; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027269; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027013; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027715; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026460; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0026988; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0027124; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0027092; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0027232; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027111; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027773; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026194; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026538; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000061826; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061187; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0061211; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0061147; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061136; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060830; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061614; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061124; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0060806; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0060902; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0060887; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0061045; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060856; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061800; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060679; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060104; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=E430016A01
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1903
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /dev_stage="2 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="E430016A01"
FT                   /cell_type="thymic cells"
FT                   /tissue_type="thymus"
FT                   /db_xref="taxon:10090"
FT   CDS             163..1158
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase,
FT                   polypeptide 3 (MGD|MGI:1349405 GB|NM_020026, evidence:
FT                   BLASTN, 99%, match=996)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q920V1"
FT                   /db_xref="InterPro:IPR002659"
FT                   /db_xref="MGI:MGI:1349405"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q920V1"
FT                   /protein_id="BAC40336.1"
FT                   /translation="MAPAVLTALPNRMSLRSLKWSLLLLSLLSFLVIWYLSLPHYNVIE
FT                   RVNWMYFYEYEPIYRQDFRFTLREHSNCSHQNPFLVILVTSRPSDVKARQAIRVTWGEK
FT                   KSWWGYEVLTFFLLGQQAEREDKTLALSLEDEHVLYGDIIRQDFLDTYNNLTLKTIMAF
FT                   RWVMEFCPNAKYIMKTDTDVFINTGNLVKYLLNLNHSEKFFTGYPLIDNYSYRGFFHKN
FT                   HISYQEYPFKVFPPYCSGLGYIMSGDLVPRVYEMMSHVKPIKFEDVYVGICLNLLKVDI
FT                   HIPEDTNLFFLYRIHLDVCQLRRVIAAHGFSSKEIITFWQVMLRNTTCHY"
FT   regulatory      1886..1891
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1903
FT                   /note="putative"
XX
SQ   Sequence 1903 BP; 523 A; 398 C; 431 G; 551 T; 0 other;
     tggttcgcgc gcagagagcg agcgcgggcc gcaccgttgc gggtaccacg ggcgcacggg        60
     aggtgtgagc cttctaagta gcatatggca aaacgttagg ccaagctgtg acagcccctg       120
     tggttaagaa cctgtgcctt ctgaacttct ctgctgctgt ggatggcccc ggctgtcttg       180
     actgcccttc ccaataggat gtcactgaga tccctcaagt ggagcctgct gctgctgtcc       240
     ctgctgagct tcctggtgat atggtacctc agcctccccc actacaatgt gatcgagcgc       300
     gtcaactgga tgtacttcta tgagtatgag ccaatttaca gacaagactt tcgcttcacg       360
     ctccgcgaac actcgaactg ttctcatcag aacccattcc tggtcatcct ggtgacctca       420
     cgcccctcag atgtgaaagc cagacaagcc attagagtta cttggggtga gaaaaagtcc       480
     tggtggggat atgaggtgct cacgtttttc ttactaggcc agcaggctga aagggaagac       540
     aaaacgttag ccctgtcctt ggaggatgag cacgttctct atggtgatat tatacggcaa       600
     gactttctag acacatataa taacttgacc ttgaaaacca ttatggcttt caggtgggta       660
     atggagtttt gccccaatgc caagtatatt atgaaaacag acactgatgt tttcatcaac       720
     actggcaatt tagtcaagta tcttttaaac ctaaaccact cagagaagtt tttcacgggc       780
     tatcctctaa ttgataacta ttcctataga ggatttttcc ataaaaacca catttcatac       840
     caagagtacc ccttcaaggt gttccctccc tactgcagcg ggctgggcta cattatgtct       900
     ggcgacctgg tgcccagggt ctacgagatg atgagtcacg tgaagcccat caagtttgaa       960
     gacgtttatg ttggcatctg tttgaatttg ttaaaagtgg acattcatat tccagaagac      1020
     acaaaccttt tctttctgta cagaatccac ttggatgtat gtcagctcag acgcgtgatt      1080
     gcagcccatg gcttttcttc caaggagatc atcacattct ggcaggtgat gctgaggaac      1140
     accacatgcc attactaagc ccatccatca cccatctagg caagggagga aggacactgt      1200
     agacagggtc agagttagca ctgtgggaaa ctcgggaagt tgagcgtgct ggtttgcctg      1260
     ggctgaaact catggagctc cctagacagg agtcaaggcc tgaacttagt gattgctttc      1320
     acagaattta acttgggtcg tttaaaggtg acagaggagt caaacataat gcaaacgaag      1380
     agttttgcta accaaatcaa agggtcagac agtctggatg gctcaggctg tagattagaa      1440
     tttcttaaga tttccctaaa agaaaaacta actagtccac agccagaata cagtgtggag      1500
     ttgtatttat tagacagtat agttacataa tggttcagtg tgtatcttaa gtggttatta      1560
     tgtaaagata tatatatata tttcttgtaa aaagctttac agagttatat tgaaaacatt      1620
     catttgtatt gttttcattt gcaaggtact caatgatatg gtacgtaaga gttatcaaat      1680
     caagtattat ttaatgtcat ttcaattttc taaatgttta aaggttatgt atggtctcag      1740
     tattatatga tgaattgcct ttcgcatttg agctttgttt tattcaccac tgatcagttt      1800
     aattaatgtg gcgttaatgt gacatcaaag gttattactg actgtccgta atctgttgaa      1860
     ctctgttgca ctgtaaacat agagaattaa agcaagaaaa ttc                        1903
//