Dbfetch

ID   AK088399; SV 1; linear; mRNA; HTC; MUS; 3948 BP.
XX
AC   AK088399;
XX
DT   19-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 2 days neonate thymus thymic cells cDNA, RIKEN full-length
DE   enriched library, clone:E430014N03 product:FRIZZLED 6 PRECURSOR
DE   (FRIZZLED-6) (FZ-6) (MFZ6), full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3948
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 53d66d9e987247fa00786e98857c0e9b.
DR   Ensembl-Gn; ENSMUSG00000022297; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000107137; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0021811; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0021771; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0021752; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0021778; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021552; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022217; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021069; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0021521; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0021645; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0021623; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0021715; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021647; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022240; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0020814; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021124; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000022906; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179165; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202117; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202152; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0040861; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0040822; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0040790; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0040821; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0040557; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0041287; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0040609; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0040474; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0040627; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0040587; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0040693; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0040574; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0041337; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0040202; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0039958; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=E430014N03
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3948
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /dev_stage="2 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="E430014N03"
FT                   /cell_type="thymic cells"
FT                   /tissue_type="thymus"
FT                   /db_xref="taxon:10090"
FT   CDS             185..2314
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="FRIZZLED 6 PRECURSOR (FRIZZLED-6) (FZ-6) (MFZ6)
FT                   (SWISSPROT|Q61089, evidence: FASTY, 100%ID, 100%length,
FT                   match=2127)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q542J1"
FT                   /db_xref="InterPro:IPR000539"
FT                   /db_xref="InterPro:IPR015526"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="InterPro:IPR026543"
FT                   /db_xref="MGI:MGI:108474"
FT                   /db_xref="UniProtKB/TrEMBL:Q542J1"
FT                   /protein_id="BAC40329.1"
FT                   /translation="MERSPFLLACILLPLVRGHSLFTCEPITVPRCMKMTYNMTFFPNL
FT                   MGHYDQGIAAVEMGHFLHLANLECSPNIEMFLCQAFIPTCTEQIHVVLPCRKLCEKIVS
FT                   DCKKLMDTFGIRWPEELECNRLPHCDDTVPVTSHPHTELSGPQKKSDQVPRDIGFWCPK
FT                   HLRTSGDQGYRFLGIEQCAPPCPNMYFKSDELDFAKSFIGIVSIFCLCATLFTFLTFLI
FT                   DVRRFRYPERPIIYYSVCYSIVSLMYFVGFLLGNSTACNKADEKLELGDTVVLGSKNKA
FT                   CSVVFMFLYFFTMAGTVWWVILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGAPGFLTV
FT                   MLLAMNKVEGDNISGVCFVGLYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQV
FT                   IQHDGRNQEKLKKFMIRIGVFSGLYLVPLVTLLGCYVYELVNRITWEMTWFSDHCHQYR
FT                   IPCPYQANPKARPELALFMIKYLMTLIVGISAVFWVGSKKTCTEWAGFFKRNRKRDPIS
FT                   ESRRVLQESCEFFLKHNSKVKHKKKHGAPGPHRLKVISKSMGTSTGATTNHGTSAMAIA
FT                   DHDYLGQETSTEVHTSPEASVKEGRADRANTPSAKDRDCGESAGPSSKLSGNRNGRESR
FT                   AGGLKERSNGSEGAPSEGRVSPKSSVPETGLIDCSTSQAASSPEPTSLKGSTSLPVHSA
FT                   SRARKEQGAGSHSDA"
FT   regulatory      3930..3935
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      3948
FT                   /note="putative"
XX
SQ   Sequence 3948 BP; 1035 A; 868 C; 899 G; 1146 T; 0 other;
     gcaccttcct ctgccgcccg agcagttgcc ccagaattca ttttcaggaa acagcttcta        60
     tcaaaatggt acaaagaatg caatgaggaa tttgtacatt ttatctctga tttgagaatc       120
     tttttgatgc ggaaaggagc ataagaataa tccaagccat gtggtaaaat cggagtctgg       180
     caagatggaa aggtccccgt ttctgttggc gtgcattctt ctgcccctcg taagaggaca       240
     cagccttttc acctgtgagc caatcaccgt tcccagatgt atgaaaatga cttacaacat       300
     gacgttcttc cctaacctga tgggtcatta tgaccagggg atcgctgctg tggaaatggg       360
     gcactttctg catcttgcaa atctagaatg ttcaccaaac attgaaatgt tcctttgcca       420
     agcttttata ccaacctgca cagagcaaat tcatgtagtt ctaccctgtc ggaaattgtg       480
     tgagaaaata gtttctgatt gcaaaaaact aatggacact tttggcatcc gatggcctga       540
     agaacttgaa tgtaacagat tgccacactg tgatgacact gttcctgtaa cttctcatcc       600
     acacacagag ctttctgggc cacagaagaa atcagatcaa gtcccaagag acattggatt       660
     ttggtgtcca aagcacctta ggacttccgg ggaccaaggc tataggtttc tgggaattga       720
     acagtgtgcc cctccgtgcc ccaatatgta ttttaaaagt gatgaactag actttgccaa       780
     aagtttcata ggaatagttt caatattttg tctttgtgca actctgttca cgttccttac       840
     atttttaatt gacgttagac gattcagata cccagagaga ccaattatct attactctgt       900
     ctgctacagc attgtctctc tcatgtactt cgtggggttt ttgctgggca atagcacggc       960
     ttgtaataag gcagacgaga agctggagct cggggacacc gttgtcctag ggtcaaagaa      1020
     taaggcttgc agtgtggtat ttatgtttct gtattttttt acaatggctg gcaccgtgtg      1080
     gtgggtgatt ctcaccatta cgtggttctt agctgccggg agaaaatgga gttgcgaagc      1140
     tattgaacaa aaagcagtgt ggttccatgc cgttgcctgg ggggcgcccg ggttcctgac      1200
     cgtcatgctg ctcgctatga ataaggttga aggagacaac attagcggcg tttgcttcgt      1260
     tggcctgtat gacctggacg cctctcgcta cttcgtcctt ctgcctctgt gcctctgcgt      1320
     atttgttggg ctgtctctcc tcttagccgg catcatctcc ttgaatcatg tccgacaagt      1380
     catacagcat gatggccgga accaagagaa gctaaagaaa ttcatgattc gcatcggagt      1440
     cttcagtggc ctgtatcttg tgcccttagt gacacttctc ggttgctatg tctatgagct      1500
     agtgaacagg atcacctggg agatgacatg gttctctgat cattgtcacc agtaccgcat      1560
     cccgtgccct taccaggcaa atccaaaagc tcgaccagaa ttggctttat ttatgataaa      1620
     atatctgatg acattaattg ttggtatctc tgcggtcttc tgggttggaa gcaaaaagac      1680
     gtgcacagaa tgggccgggt tctttaagcg aaaccgcaag cgagacccca tcagtgagag      1740
     ccgccgagtg ctgcaagagt cctgtgagtt cttcctgaag cacaactcta aagtgaagca      1800
     caagaagaag catggcgcac cagggcctca taggctgaag gtcatttcca agtccatggg      1860
     aactagcaca ggagcgacca caaatcatgg cacctctgcc atggcaatcg ctgaccatga      1920
     ttacttaggg caagaaactt caacagaagt ccacacctcc ccagaagcat ccgtcaaaga      1980
     gggacgagca gaccgagcaa acactcccag cgccaaagat cgggactgtg gggaatctgc      2040
     agggcccagt tccaagctct ctgggaaccg gaacggcagg gaaagccgag cgggcggcct      2100
     gaaggagaga agcaatggat cagagggggc tccaagtgaa ggaagggtaa gtccaaagag      2160
     cagcgttcct gagactggcc tgatagactg cagcacttca caggccgcca gttctccaga      2220
     accaaccagc ctcaagggct ccacatctct gcctgttcac tcagcttcca gagctaggaa      2280
     agagcagggt gctggcagcc attccgacgc ttgaagaaaa ctgtctcgtt cccccagaag      2340
     cacatgtatg ttacactgga gatgaccaac tgatttgtct tataaaggcc actgttgagc      2400
     tgggagagta gcccagtggt acagcgccca cctggaatac ttgaggacct ggggttgtct      2460
     cccagcactg caaaaggaaa attcactgtt acagtcttcc ttgcacttaa accagctttg      2520
     tctattgttt ttttggtttg gcttttattt ttgttgctgt tatttttgtt gttgtttgtt      2580
     tgtttttttg tttgtttgtt tgagacaggg tttctttgct agccctgact gtcctgaaac      2640
     tccctctgta gaccaggctg gcctcaaact tacagagatc tgcctgcctc agcctcccga      2700
     gtgctgggaa taatggtgtg gtcaccactg cccagccttt tgtctgtttt taaacttgaa      2760
     agaaacaaca gcccagattt caaaaataat ataatgcatt tatacctaaa aaaccaacca      2820
     ggagtgccca gttaataaca ctttttaaat gtggggatgg gaagggcatt agaggagtct      2880
     tccttctatt gaagattcat taaagtattt taagatatgc tctttcactc tttatataaa      2940
     tccaagattt ttctttgctg aagtatttaa aacttttgta cctttatatg tagatatgaa      3000
     tttgaaaata tgcttatgtg tatttgaact tttgaaaatc ctagagaatt gaatcaaata      3060
     tttttatgat gtttttctac tattttagct actttgcgac tgtgatagct gttacactgg      3120
     atttttaaaa aacttgtaca gcagcctctt tacagtaaaa agagtgggtg tcacactgaa      3180
     aggtctgtaa gaagtggtca cagccacccc taccttcccc aaaaggagga acttggtggc      3240
     aggtccctcc ctgattggac tgtccctttc tttctgcatg ttataaatca gcaggtaaga      3300
     tggtaggttt ttacaagtta ggccgagctg tcgattcccc ttttaagtgt tgaattagga      3360
     ttgaattatg gccatttgta gttgctcgtg cctgtcttta ttttagtatt ttatttcccg      3420
     agacaggaac tcactgtgtg gtgctccttg gctgtctggt gttcagtctg tcccaggcag      3480
     gtcacagaga tctccccctc tgcagcccac tcatctctcc caagccacca cactcagctt      3540
     ttatctgttt taaaaattta aacttaaaaa aatgtttttg gaatagtaca aacacattgt      3600
     gttgtaaatt tctttgatgc tatgcaaaat tcctatctgc atctaagcct gcaaaagaaa      3660
     atgtgcgaag ggcagagtca gagttgggca ggaagagtgt agtgcagcag atgcagcgtg      3720
     aagacactga aggtgctaag acagcgtctc agtgctggtc ctccttaagg attatctcgc      3780
     cagcgaggtt ttcttagata ctttgatccc attggagctc tgttaaagtt taaaatgaaa      3840
     attatcatgt actgtatggg aaatgtaaat actaactttt ccacatatgt aaacttcaga      3900
     cacaaatttt tttgtgtgtt cttttcatca ataaaatttt ctttgtat                   3948
//