Dbfetch

ID   AK088009; SV 1; linear; mRNA; HTC; MUS; 869 BP.
XX
AC   AK088009;
XX
DT   19-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus 2 days neonate thymus thymic cells cDNA, RIKEN full-length
DE   enriched library, clone:E430002C21 product:regulator of G-protein
DE   signalling 10, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-869
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 57495153ab4c8b7a173cefb750a6ca33.
DR   Ensembl-Gn; ENSMUSG00000030844; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033082; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0033064; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0032996; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033065; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032779; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033575; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032109; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032752; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032904; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032857; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0032998; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032889; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033594; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031815; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032220; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000033133; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0087009; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0087090; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0087028; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0087050; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0086611; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0087550; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0087130; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0086556; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0086750; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0086593; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0086782; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0086631; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0087844; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0086538; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0085650; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=E430002C21
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..869
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /dev_stage="2 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="E430002C21"
FT                   /cell_type="thymic cells"
FT                   /tissue_type="thymus"
FT                   /db_xref="taxon:10090"
FT   CDS             58..603
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="regulator of G-protein signalling 10
FT                   (MGD|MGI:1915115 GB|NM_026418, evidence: BLASTN, 100%,
FT                   match=869)"
FT                   /db_xref="GOA:Q9CQE5"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR024066"
FT                   /db_xref="InterPro:IPR036305"
FT                   /db_xref="InterPro:IPR037879"
FT                   /db_xref="MGI:MGI:1915115"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CQE5"
FT                   /protein_id="BAC40091.1"
FT                   /translation="MFTRAVSRLSRKRPPSDIHDGDGSSSSGHQSLKSTAKWASSLENL
FT                   LEDPEGVQRFREFLKKEFSEENVLFWLACEDFKKTEDRKQMQEKAKEIYMTFLSNKASS
FT                   QVNVEGQSRLTEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKPKRTEEEEE
FT                   EPPDAQTAAKRASRIYNT"
FT   regulatory      850..855
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      869
FT                   /note="putative"
XX
SQ   Sequence 869 BP; 236 A; 216 C; 225 G; 192 T; 0 other;
     tcttcgggct tagccgccgc gctgcccggc tgctccgtcc tctggacgcc cgcggcgatg        60
     ttcacccgcg ccgtgagccg actgagcagg aagcggccgc cgtctgatat ccatgacgga       120
     gatgggagct caagcagcgg ccaccagagc cttaagagca cagccaagtg ggcatcctcc       180
     ctggagaatc ttctggaaga cccagaaggg gtgcagagat tcagggagtt tctgaagaag       240
     gaattcagcg aagagaatgt cttgttttgg ctagcgtgtg aagatttcaa gaaaacggag       300
     gacaggaagc agatgcagga aaaggccaag gagatctaca tgaccttcct gtccaataag       360
     gcctcttcac aagtcaacgt ggaggggcag tctcggctca ctgaaaagat tctggaagag       420
     ccacaccctc tgatgttcca aaagctccag gaccagatct tcaatctcat gaagtatgac       480
     agctacagcc gcttcttgaa gtctgacttg tttctgaaac ccaagcgaac tgaggaagag       540
     gaagaagagc ccccggatgc tcagaccgca gctaagcgag cctccagaat ttacaacaca       600
     taagctgagc ccttcacccc agcgaaggag agggatggac tcttaggact gtacaggctg       660
     tcatttcttt gttgtgtttg aggactggag tgtgctagac cttccctctg gatatgtgta       720
     ttttattaac tgaacagcaa cctctgcatg atgctaatct tccattaaaa acaaaagtag       780
     ctttaaagtg tcagttcaca aaaacacatg agattctgcc aatactggac actcagcctt       840
     tcaatcctga ttaaagtgtt cgtgaagct                                         869
//