spacer

EBI Dbfetch

ID   AK087481; SV 1; linear; mRNA; HTC; MUS; 2360 BP.
XX
AC   AK087481;
XX
DT   19-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 0 day neonate eyeball cDNA, RIKEN full-length enriched
DE   library, clone:E130304L23 product:K+ voltage-gated channel, subfamily S, 2,
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2360
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; fc4b00d4c3193203edf508a1b5d4c66c.
DR   Ensembl-Gn; ENSMUSG00000050963; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072868; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=E130304L23
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2360
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="0 day neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="E130304L23"
FT                   /tissue_type="eyeball"
FT                   /db_xref="taxon:10090"
FT   CDS             222..1655
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="K+ voltage-gated channel, subfamily S, 2
FT                   (MGD|MGI:1197011 GB|NM_008436, evidence: BLASTN, 99%,
FT                   match=2143)"
FT                   /note="putative"
FT                   /db_xref="GOA:O35174"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR003091"
FT                   /db_xref="InterPro:IPR003131"
FT                   /db_xref="InterPro:IPR003968"
FT                   /db_xref="InterPro:IPR003971"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="MGI:MGI:1197011"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35174"
FT                   /protein_id="BAC39892.1"
FT                   /translation="MTRQSLWDVSDTDVEDGEIRINVGGFKRRLRSHTLLRFPETRLGR
FT                   LLLCHSREAILELCDDYDDVQREFYFDRNPELFPYVLHFYHTGKLHVMAELCVFSFSQE
FT                   IEYWGINEFFIDSCCSYSYHGRKVEPEQEKWDEQSDQESTTSSFDEILAFYNDASKFDG
FT                   QPLGNFRRQLWLALDNPGYSVLSRVFSVLSILVVLGSIITMCLNSLPDFQIPDSQGNPG
FT                   EDPRFEIVEHFGIAWFTFELVARFAVAPDFLKFFKNALNLIDLMSIVPFYITLVVNLVV
FT                   ESSPTLANLGRVAQVLRLMRIFRILKLARHSTGLRSLGATLKYSYKEVGLLLLYLSVGI
FT                   SIFSVVAYTIEKEENEGLATIPACWWWATVSMTTVGYGDVVPGTTAGKLTASACILAGI
FT                   LVVVLPITLIFNKFSHFYRRQKQLESAMRSCDFGDGMKEVPSVNLRDYYAHKVKSLMAS
FT                   LTNMSRSSPSELSLDDSLH"
XX
SQ   Sequence 2360 BP; 524 A; 612 C; 596 G; 628 T; 0 other;
     taggcgcacg gtggaccccg cctgcccggt ggcggggcac acagacaagc actcacatct        60
     acatcctcgc acccgcgcgc actcgcgcag ccagccaacg gcgtccaccg cggtgatgct       120
     tgccagcagg tcggggaagt ttcccgccgg cctctgccgc gggctcccgt gcacccaggt       180
     gtagcgcccc cgcgcggcgc gggcgcctgg gcatctccag catgacccgc cagagcctgt       240
     gggatgtgtc cgataccgac gtcgaggatg gagagatccg catcaatgtg ggtggcttca       300
     agagacggct gcgttcccat acgctgctgc gcttccctga gacacgcctg ggccgtctgc       360
     tcctctgcca ctcgcgagag gccattctgg aactctgcga tgactacgat gacgttcagc       420
     gtgagttcta cttcgaccgt aaccccgagc tcttccccta tgtgttgcat ttctaccaca       480
     ccggcaagct tcacgtcatg gctgagctgt gcgtcttctc cttcagccag gagatcgagt       540
     actggggtat caatgagttc ttcatcgact cttgctgcag ctatagctat cacggccgca       600
     aagtggaacc tgagcaggag aaatgggacg agcagagtga ccaggaaagc accacttcct       660
     ccttcgatga gatcttggcc ttctataatg atgcttccaa gttcgatggg caacccctgg       720
     gcaacttccg caggcagctg tggctggcgt tggacaaccc aggctactca gtcctaagca       780
     gggtcttcag tgtcctttcc atcttggtgg tgttgggctc catcatcacc atgtgcctca       840
     atagcctgcc agacttccaa atccctgata gccagggtaa ccccggtgaa gaccccaggt       900
     tcgaaattgt ggagcacttt ggcattgctt ggttcacatt tgagttggtg gccaggtttg       960
     ctgtggcccc tgactttctt aagttcttca agaatgctct aaaccttatt gatctcatgt      1020
     ccattgtccc attttacata actctagtgg tgaacctggt ggtggagagt tctcctacct      1080
     tggctaactt gggcagggtg gctcaagtcc tgaggctaat gaggatcttc cgaattctca      1140
     agctggccag acactccact ggcctccgct ccttgggagc caccctgaag tacagctaca      1200
     aggaagtggg gttgctcttg ctctacctct cagtggggat ttccatcttc tctgtggtgg      1260
     cctacaccat tgaaaaggag gagaacgaag gcctggccac catccctgcc tgctggtggt      1320
     gggccactgt cagtatgacc acagttgggt acggagatgt ggtcccaggg acaacagctg      1380
     ggaagttgac tgcctctgcc tgcatcttgg caggcatcct ggtggtggtc ttgcccatca      1440
     ctttgatctt caataagttc tcccatttct atcggcgcca aaagcaactt gagagtgcta      1500
     tgcgcagctg tgactttgga gatggaatga aagaggtccc ttcggtcaat ttaagggact      1560
     actatgctca taaagttaag tccctcatgg caagtctgac aaacatgagt aggagttcac      1620
     ctagtgaact gagtttagat gattctctac attagctgga ccccgactta cattgctgat      1680
     ctgctgcttg tggttctagc acaatcaggg caattttagg ggctgtggca taagaaatca      1740
     tccctgccct agagggagag ctgcatggga cataagccct agattgcttt tgcaatgttt      1800
     agagaggttt cttttttctt ttgaggatgg tgtgtctaat aacatgcctt tgcacctctc      1860
     agtgaagtga cactcactgg tgtttgcatc atggcaaaaa aaaaaatgtt cacctttctg      1920
     ccagatgagt atctagaatg ccaatttctc tgtccactgt gtacagtatt ctaatgctca      1980
     tatcccagca ttacctgtga gtggaattgt ctgtgctcct atttccgagg ctgctgtatg      2040
     ggttccagtg acaacacatc tgtctatgag gtcagcaagg atatcgtgag atttggatca      2100
     caaccatgtg aaaataatct caattatgta tcccttgctt tcatttacct ttaataccaa      2160
     aacagagaga tcgcaaagct aagcacactt gaccaatgca aatcttcgag ttgtctttct      2220
     acttggtcct gtccttgtga tgtgcatgaa tgcaccagtc attttaaaga aagatatgta      2280
     ttgatgtata tctcctaagt gtcagtgtaa agagaatgtt acttagtcga tatgtagtaa      2340
     agactgaatg tttttcctcc                                                  2360
//


spacer
spacer