spacer

EBI Dbfetch

ID   AK087395; SV 1; linear; mRNA; HTC; MUS; 831 BP.
XX
AC   AK087395;
XX
DT   19-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 0 day neonate eyeball cDNA, RIKEN full-length enriched
DE   library, clone:E130006F23 product:solute carrier family 17 (anion/sugar
DE   transporter), member 5, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-831
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; a7ee77182e59e190aa8181d25d217d2a.
DR   Ensembl-Gn; ENSMUSG00000049624; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052441; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117645; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119213; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=E130006F23
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..831
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="0 day neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="E130006F23"
FT                   /tissue_type="eyeball"
FT                   /db_xref="taxon:10090"
FT   CDS             62..778
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="solute carrier family 17 (anion/sugar transporter),
FT                   member 5 (MGD|MGI:1924105, evidence: Direct assignment)"
FT                   /db_xref="GOA:Q8BN82"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:1924105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BN82"
FT                   /protein_id="BAC39859.1"
FT                   /translation="MRPLLRGPAGNDDEESSDSTPLLPGARQTEAAPVCCSARYNLAIL
FT                   AFCGFFVLYALRVNLSVALVDMVDSNTTLTDNRTSKECAEHSAPIKVHHNHTGKKYKWD
FT                   AETQGWILGSFFYGYIVTQIPGGYIASRVGGKLLLGLGILGTSVFTLFTPLAADLGVVT
FT                   LVVLRALEGLGEKYPPPGCYVSSYARHVVFLGSPSGKKQASYHFLCGSTAWDSDLTSSF
FT                   RNNMLLYELDLRLLSF"
XX
SQ   Sequence 831 BP; 184 A; 216 C; 221 G; 210 T; 0 other;
     ggtcctgccg agagctaggt tggccaagca acgacgccgg cacatctgct ctccaggcgt        60
     tatgaggccc ctgcttcggg gtccggcggg aaacgacgat gaggagagct cggacagcac       120
     cccgctcctg ccgggcgccc ggcagaccga agcggctcca gtgtgctgct ctgctcggta       180
     caacttagcg attttggcgt tctgtggttt cttcgttctc tatgccttac gggtgaacct       240
     gagtgttgcg ttagtggaca tggtagattc aaatacaact ctgactgata atagaacgtc       300
     taaggagtgt gcggaacatt ctgcccccat aaaagttcac cacaatcaca caggtaaaaa       360
     gtacaagtgg gatgcagaaa ctcaagggtg gattctcggc tctttttttt acggctacat       420
     cgtcacccag attcccggtg ggtacattgc cagcagggtc ggagggaagc tgctgctggg       480
     cctgggcatc ttaggcacct ccgtcttcac cctgttcaca ccgctggccg cagacttagg       540
     cgtggtgact ctcgttgtgc ttagagcgct ggaaggactg ggagagaaat atccaccccc       600
     agggtgttac gtttccagct atgcacgcca tgtggtcttc ctgggctccc cctctggaaa       660
     gaagcaagct tcttaccatt tcctatgcgg gagcacagct tgggacagtg atctcacttc       720
     ctctttccgg aataatatgc tactatatga actggactta cgtcttctat ctttttgagt       780
     tgtgtaaaaa tttctcgata gaaaaggctt aagaaaaact tcaaatctct g                831
//


spacer
spacer