spacer

EBI Dbfetch

ID   AK087387; SV 1; linear; mRNA; HTC; MUS; 1066 BP.
XX
AC   AK087387;
XX
DT   19-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus 0 day neonate eyeball cDNA, RIKEN full-length enriched
DE   library, clone:E130003J05 product:myosin heavy chain (fragment) homolog
DE   [Gallus gallus], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1066
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 4e062276a6cea9329ec34a13a1737d93.
DR   Ensembl-Gn; ENSMUSG00000055775; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108685; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=E130003J05
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1066
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="0 day neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="E130003J05"
FT                   /tissue_type="eyeball"
FT                   /db_xref="taxon:10090"
FT   CDS             96..683
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="myosin heavy chain (fragment) homolog [Gallus
FT                   gallus] (PIR|B25217, evidence: FASTY, 93.4%ID, 98.8%length,
FT                   match=498)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8BGE8"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR004009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1339712"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BGE8"
FT                   /protein_id="BAC39855.1"
FT                   /translation="MSAGSDAEMAIFGEAAPYLRKSEKERIEAQNKPFDAKTSVFVAEP
FT                   KESYVKSVIQSKDGGKVTVKTESGATLTVKEDQVFPMNPPKYDKIEDMAMMTHLHEPGV
FT                   LYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNPEVVAAYRGKKRQEAPPHIFSISDN
FT                   AYQFMLTVISTLGCERGHSGIHWPAQANRASK"
XX
SQ   Sequence 1066 BP; 320 A; 266 C; 239 G; 241 T; 0 other;
     gatctccgcc aagagcccag agtgaaggac aggcgtgact ctacgttttc atccagagct        60
     ccatagctga aacctcggct aaataagtag cagccatgag tgcgggttcg gacgcggaga       120
     tggctatttt tggcgaagct gctccttacc tccgaaaatc ggagaaggag aggattgagg       180
     cccaaaataa gccttttgac gcaaaaacat ctgtctttgt ggcggagccc aaggagtctt       240
     atgtgaaaag cgttatacaa agcaaggatg gagggaaagt gaccgtgaag acggaaagtg       300
     gagcaactct caccgtcaag gaagatcaag tcttccccat gaaccctccc aaatatgaca       360
     agatcgagga catggccatg atgacccacc tccatgagcc cggagtgctg tacaacctca       420
     aagagcgtta tgcagcctgg atgatctata cctactcagg cctcttctgt gtcaccgtca       480
     acccctacaa gtggctgccg gtgtacaacc ctgaggtggt ggcagcctac cgaggcaaaa       540
     agcgccagga ggccccaccc cacatcttct ccatctctga caacgcctac cagttcatgc       600
     tgacggtcat ctccacttta ggatgtgaac ggggacactc tggaattcac tggcctgccc       660
     aagccaacag ggctagcaaa taacaactca gataaagcaa agagccagtt tctgaaaaca       720
     gatttgttca ttttttttcc aacttggata caaaaaagtt caaacagatc cctttaaaag       780
     taccttctca acagcctaaa aaagaggtct caggcatatc cagagaactc tgaattctta       840
     tgtggatttt caaatgacac agccgatgat gccagctttg gagacagagc aagagtaagc       900
     tggagataga gcatggataa agagaactta taaaattcct cccatggact ttgaaacatt       960
     ctcctattca agtctgctag ttctgcatta tcaaagcaca ctcatgatcg gtcccagaac      1020
     agcactaaaa ccttttatct tcacatataa atgcctctgg atatgt                     1066
//


spacer
spacer