spacer

EBI Dbfetch

ID   AK085754; SV 1; linear; mRNA; HTC; MUS; 2316 BP.
XX
AC   AK085754;
XX
DT   19-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 10 days lactation, adult female mammary gland cDNA, RIKEN
DE   full-length enriched library, clone:D730049G12 product:transferrin, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2316
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; c5c14339609b260574e8cc4384e832d3.
DR   Ensembl-Gn; ENSMUSG00000032554; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035158; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112645; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=D730049G12
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2316
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="10 days lactation, adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="D730049G12"
FT                   /tissue_type="mammary gland"
FT                   /db_xref="taxon:10090"
FT   CDS             56..2149
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="transferrin (MGD|MGI:98821 GB|J03299, evidence:
FT                   BLASTN, 99%, match=393)"
FT                   /db_xref="GOA:Q921I1"
FT                   /db_xref="InterPro:IPR001156"
FT                   /db_xref="InterPro:IPR016357"
FT                   /db_xref="InterPro:IPR018195"
FT                   /db_xref="MGI:MGI:98821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q921I1"
FT                   /protein_id="BAC39532.1"
FT                   /translation="MRLTVGALLACAALGLCLAVPDKTVKWCAVSEHENTKCISFRDHM
FT                   KTVLPPDGPRLACVKKTSYPDCIKAISASEADAMTLDGGWVYDAGLTPNNLKPVAAEFY
FT                   GSVEHPQTYYYAVAVVKKGTDFQLNQLEGKKSCHTGLGRSAGWVIPIGLLFCKLSEPRS
FT                   PLEKAVSSFFSGSCVPCADPVAFPKLCQLCPGCGCSSTQPFFGYVGAFKCLKDGGGDVA
FT                   FVKHTTIFEVLPEKADRDQYELLCLDNTRKPVDQYEDCYLARIPSHAVVARKNNGKEDL
FT                   IWEILKVAQEHFGKGKSKDFQLFSSPLGKDLLFKDSAFGLLRVPPRMDYRLYLGHNYVT
FT                   AIRNQQEGVCPEGSIDNSPVKWCALSHLERTKCDEWSIISEGKIECESAETTEDCIEKI
FT                   VNGEADAMTLDGGHAYIAGQCGLVPVMAEYYESSNCAIPSQQGIFPKGYYAVAVVKASD
FT                   TSITWNNLKGKKSCHTGVDRTAGWNIPMGMLYNRINHCKFDEFFSQGCAPGYEKNSTLC
FT                   DLCIGPLKCAPNNKEEYNGYTGAFRCLVEKGDVAFVKHQTVLDNTEGKNPAEWAKNLKQ
FT                   EDFELLCPDGTRKPVKDFASCHLAQAPNHVVVSRKEKAARVKAVLTSQETLFGGSDCTG
FT                   NFCLFKSTTKDLLFRDDTKCFVKLPEGTTPEKYLGAEYMQSVGNMRKCSTSRLLEACTF
FT                   HKH"
FT   polyA_signal    2295..2300
FT                   /note="putative"
FT   polyA_site      2316
FT                   /note="putative"
XX
SQ   Sequence 2316 BP; 574 A; 587 C; 633 G; 522 T; 0 other;
     ggcagaagcg ggtcggtctg tactccccgc tcctcgccac acacacaccg agaggatgag        60
     gctcaccgtg ggtgccctgc tggcctgcgc tgccctgggg ctgtgtctgg ctgtccctga       120
     caaaacggtc aaatggtgcg cagtgtcaga gcacgagaat accaagtgca tcagcttccg       180
     tgaccacatg aagaccgtcc ttccgcctga tggcccccgg cttgcctgtg tgaagaaaac       240
     ctcctatccg gattgcatca aggccatttc tgcaagtgaa gccgatgcta tgaccttgga       300
     tgggggttgg gtgtacgatg ccggcctgac tccgaacaac ctgaagcccg tggcggcgga       360
     gttttatgga tcagtggaac atccacagac ctactactac gctgtggctg tggtaaagaa       420
     gggaacagac ttccagctga accagctcga aggcaagaag tcctgccaca caggcctggg       480
     aaggtctgca ggctgggtca tccccattgg cttgctcttc tgtaagctgt cggagccccg       540
     cagtcctctt gagaaagctg tgtccagttt cttctcgggc agttgtgtcc cctgtgcaga       600
     tccagtggcc ttccccaaac tgtgtcaact gtgcccaggc tgtggctgct cctccactca       660
     accattcttt ggctacgtag gcgcattcaa gtgtctgaaa gatggcggtg gggatgtggc       720
     ctttgtcaag cacacaacca tatttgaggt cttgccggag aaggctgaca gggaccaata       780
     tgaactgctc tgccttgaca atacccgcaa gccagtggat cagtatgagg attgctacct       840
     ggctcggatc ccttctcatg ctgttgtggc tcgaaaaaac aatggcaagg aagacttgat       900
     ctgggagatt ctcaaagtgg cacaggaaca ctttggcaaa ggcaaatcaa aagacttcca       960
     actgttcagc tctcctcttg ggaaagacct gctgtttaaa gattctgcct ttgggctgtt      1020
     aagggtcccc ccaaggatgg actacaggct gtaccttggc cataactatg tcactgccat      1080
     tcggaatcag caggaaggcg tgtgcccgga gggctcgatc gacaactcgc cagtgaagtg      1140
     gtgtgcactg agtcacctgg agagaaccaa gtgtgacgag tggagcatca tcagtgaggg      1200
     aaagatagag tgtgagtcag cagagaccac tgaggactgc attgaaaaga ttgtgaacgg      1260
     agaagcggac gccatgactt tggatggagg acatgcctac attgcaggcc agtgtggtct      1320
     agtgcctgtc atggcagagt actacgagag ctctaattgt gccatcccat cacaacaagg      1380
     tatctttcct aaagggtatt atgccgtggc tgtggtgaag gcatcggaca ctagcatcac      1440
     ctggaacaac ctgaaaggca agaagtcctg ccacactggg gtagacagaa ccgctggttg      1500
     gaacatccct atgggcatgc tgtacaacag gatcaaccac tgcaaattcg atgaattttt      1560
     cagtcaaggc tgcgctcccg ggtatgagaa gaattccacc ctctgtgacc tgtgtattgg      1620
     cccactcaaa tgtgctccga acaacaaaga ggaatataat ggttacacag gggctttcag      1680
     gtgtctcgtt gagaaaggag atgtagcctt tgtgaaacac cagactgtcc tggataacac      1740
     cgaaggaaag aaccctgccg aatgggctaa gaatctgaag caggaagact tcgagttgct      1800
     ctgccctgat ggcaccagga agcctgtgaa agattttgcc agctgccacc tggcccaagc      1860
     tccaaaccat gttgtggtct cacgaaaaga gaaggcagcc cgggttaagg ctgtactgac      1920
     tagccaggag actttatttg ggggaagtga ctgcaccggc aatttctgtt tgttcaagtc      1980
     caccaccaag gaccttctgt tcagggatga caccaaatgt ttcgttaaac ttccagaggg      2040
     taccacacct gaaaaatact taggagcgga gtacatgcaa tctgtcggta acatgaggaa      2100
     gtgctcaacc tcacgactcc tggaagcctg cactttccac aaacattaaa atccaagagg      2160
     tgggttgcca ctgtggtgga gacagatgct ccctcccgtg gcccatgggc ttctcttggt      2220
     cttcatgccc tgaggggttg gggctaactg gtgtagtctt cgctgctgtg ccttaccaca      2280
     tacacagagc acaaaataaa aacgactgct gacttt                                2316
//


spacer
spacer