spacer

EBI Dbfetch

ID   AK084328; SV 1; linear; mRNA; HTC; MUS; 2302 BP.
XX
AC   AK084328;
XX
DT   19-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus 12 days embryo eyeball cDNA, RIKEN full-length enriched
DE   library, clone:D230024E15 product:glutathione reductase 1, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2302
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 58db1032f9076231f92707f74277157d.
DR   Ensembl-Gn; ENSMUSG00000031584; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033992; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=D230024E15
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2302
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="12 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="D230024E15"
FT                   /tissue_type="eyeball"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..1435
FT                   /codon_start=2
FT                   /transl_table=1
FT                   /note="glutathione reductase 1 (MGD|MGI:95804 GB|NM_010344,
FT                   evidence: BLASTN, 98%, match=1571)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:P47791"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006322"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="MGI:MGI:95804"
FT                   /db_xref="UniProtKB/Swiss-Prot:P47791"
FT                   /protein_id="BAC39162.1"
FT                   /translation="TCAMASPGEPQPPAPDTSSFDYLVIGGGSGGLASARRAAELGARA
FT                   AVVESHKLGGTCVNVGCVPKKVMWNTAVHSEFMHDHVDYGFQSCEGKFSWHVIKQKRDA
FT                   YVSRLNTIYQNNLTKSHIEIIHGYATFADGPRPTVEVNGKKFTAPHILIATGGVPTVPH
FT                   ESQIPGASLGITSDGFFQLEDLPSRSVIVGAGYIAVEIAGILSALGSKTSLMIRHDKVL
FT                   RNFDSLISSNCTEELENAGVEVLKFTQVKEVKKTSSGLELQVVTSVPGRKPTTTMIPDV
FT                   DCLLWAIGRDPNSKGLNLNKVGIQTDEKGHILVDEFQNTNVKGVYAVGDVCGKALLTPV
FT                   AIAAGRKLAHRLFECKQDSKLDYDNIPTVVFSHPPIGTVGLTEDEAVHKYGKDNVKIYS
FT                   TAFTPMYHAVTTRKTKCVMKMVCANKEEKVVGIHMQGIGCDEMLQGFAVAVKMGATKAD
FT                   FDNTVAIHPTSSEELVTLR"
XX
SQ   Sequence 2302 BP; 557 A; 523 C; 586 G; 636 T; 0 other;
     gacctgcgcc atggcgagtc ccggcgagcc gcagcccccg gccccggaca cctcttcctt        60
     cgactacctg gtgatcggcg gcggctccgg cgggctggcc agcgcgcggc gggcggcgga       120
     gctcggcgcc agggccgcgg tggtggagag tcacaagctg ggtggcactt gcgtgaatgt       180
     tggatgtgta cccaaaaagg taatgtggaa cacagcagtg cactcggaat tcatgcacga       240
     tcacgtggat tacggctttc aaagctgtga gggtaaattc agttggcatg tcatcaagca       300
     gaaaagggat gcctatgtga gccgcctgaa caccatctat caaaataatt taaccaagtc       360
     tcacatagaa attatccacg gctatgcaac attcgcagat ggtcctcggc ccacggtgga       420
     agtcaatggg aaaaagttta ccgctccaca catcctgatt gccacaggag gcgtgcccac       480
     agttcctcac gagagccaga tcccaggcgc cagcctgggg atcaccagtg atggcttctt       540
     tcagctggag gacttgccca gccgcagcgt catcgtgggg gccgggtaca ttgctgtgga       600
     gatcgcgggc atcctctctg ccctgggctc caagacatct cttatgatca ggcatgataa       660
     ggtactgaga aattttgatt cactcatcag ttccaactgc accgaggaac tggagaatgc       720
     cggcgtggag gtgttgaagt tcacacaggt taaggaagta aaaaagacat catcaggcct       780
     ggagctccaa gtggtgactt ccgtgcctgg taggaagccc accacgacca tgattccaga       840
     tgttgactgc ctgctctggg ccattggacg ggacccaaat tctaagggcc tgaatctgaa       900
     taaagtgggc attcagacgg atgaaaaggg ccacatccta gtagacgaat tccagaatac       960
     caatgtcaaa ggcgtctatg ctgtgggaga cgtctgtggg aaagcgcttc tcaccccagt      1020
     tgcaatcgct gctggccgga aacttgccca tagactgttt gaatgcaaac aagattccaa      1080
     attagactat gacaacatcc ctactgtggt cttcagccac ccccctattg ggaccgtggg      1140
     gctcactgaa gacgaagctg ttcataagta tgggaaagac aatgtgaaaa tctactcgac      1200
     tgcctttacc ccgatgtatc acgctgtgac cacgaggaag acgaaatgcg tcatgaagat      1260
     ggtttgtgcc aacaaagagg aaaaggtggt tggcattcac atgcagggga ttggctgtga      1320
     tgagatgctg cagggcttcg ctgtagcggt gaaaatgggg gccaccaagg ccgacttcga      1380
     caacacagtt gccattcatc ctacctcttc agaggagctg gtcaccctgc gctgagagcc      1440
     tggggaccca ggtggctagc ggtgcgacca gcaggcctcc gggaggaacc gatcgagttt      1500
     acgcccagct tctacagatc tctgtatttt aatcaggaat ttctggtggt gtaaatttcc      1560
     agctatacac acgcacagaa gaacttatgt atctaatcag aaggttgttt tgttaatccg      1620
     gggttggttt tcatttgata atatttataa ttaatatttt gatttttttg ttgttgttta      1680
     attaacagcc ttgtgtttgt tgtgtttttc ttgctttggc cccattccaa gtttaaatgt      1740
     acatgacata cactcaagtt agtgtacctg atggatgaat attgctggct aatttctttt      1800
     attttttatt tttttccttt ttttatgcag cccaaggtgg cctcaaacaa ctcagaatcc      1860
     tccaggctat agcctcatgg gtgctggaat tctaggcctg catggcctct cctggcctag      1920
     cttgctagtt ttatatgatg ggaagtctgc agaatatacg tggtattttt gttctgtatt      1980
     ggaaagctgc cccaatgtta cctctctatt cttgttttat tctttgctct gtgttaaatg      2040
     atttaaaatg gtttgtgtta ttttcatgga acaaagtgca ttaaagttag acttgaggct      2100
     ggttaggtaa aggagaaatg acagtacatg caagacggaa ggctgaggca ctcgggagcc      2160
     ctttcttctt ctgagtattc ctggttcatt cagtcatttc tgtatctctg cgtttgtttt      2220
     tttttttttg ttttgttttt tatgaaaact gttccaaatt tttgaaattc actgcattgt      2280
     cttataaaat ttattacgaa ct                                               2302
//


spacer
spacer