spacer

EBI Dbfetch

ID   AK084111; SV 1; linear; mRNA; HTC; MUS; 1840 BP.
XX
AC   AK084111;
XX
DT   19-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 12 days embryo spinal ganglion cDNA, RIKEN full-length
DE   enriched library, clone:D130095E01 product:hypothetical Eukaryotic protein
DE   of unknown function, DUF279 containing protein, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1840
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; e7648eb491195398aeb9e4c96fe839df.
DR   Ensembl-Gn; ENSMUSG00000004843; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000004965; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=D130095E01
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1840
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="12 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="D130095E01"
FT                   /tissue_type="spinal ganglion"
FT                   /db_xref="taxon:10090"
FT   CDS             192..833
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="hypothetical Eukaryotic protein of unknown function,
FT                   DUF279 containing protein (Pfam|PF03357, evidence:
FT                   InterPro)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8BJF9"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="MGI:MGI:1916192"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BJF9"
FT                   /protein_id="BAC39118.1"
FT                   /translation="MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELE
FT                   IKKMAKIGNKEACRVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMST
FT                   TAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIV
FT                   NQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD"
FT   polyA_signal    1822..1827
FT                   /note="putative"
FT   polyA_site      1840
FT                   /note="putative"
XX
SQ   Sequence 1840 BP; 557 A; 384 C; 410 G; 489 T; 0 other;
     tggagcaccc aggacgcgtt ctcgggagcc tcgcggagcc acgcccgccg caggtcgagc        60
     ttggagaccc cgtcctcctc ctcccgccgc tgccaggctt ctccgggatc cgtccttcta       120
     ccggtcctgt tcccagaacc gggccggacc gaaccgggcc gagctgggcc gcccgggcgc       180
     ggccgctcac catggcctcc ctcttcaaga agaagactgt ggacgatgtc ataaaggaac       240
     agaatcgaga gctgcgtggc acccagaggg ccatcatcag ggaccgagca gccttagaga       300
     aacaggagaa acagctggag ttagaaatta agaagatggc caagattggt aataaggaag       360
     cgtgcagggt tttagctaag cagcttgtcc acctacggaa acagaagaca agaacgttcg       420
     ctgtaagctc aaaagtcacc tctatgtcca cacaaacgaa agtgatgaat tcccagatga       480
     agatggccgg tgccatgtct accactgcaa agacaatgca agcagtcaac aagaaaatgg       540
     atccacagaa gacactacaa acaatgcaga atttccagaa ggaaaacatg aaaatggaaa       600
     tgactgaaga aatgatcaat gacaccctgg atgacatctt tgatggctct gatgatgaag       660
     aagaaagcca ggacatcgtg aatcaagttc ttgatgaaat tgggattgaa atctctggaa       720
     agatggccaa agctccatcg gctgcaagaa gcttaccgtc tgcctccact tcaaaggcta       780
     caatttctga tgaagagatt gaacgtcaac tcaaagcttt aggggtagat tagatcaaaa       840
     gccatacata ctgttctcac ttgagtctaa agtgagtccg gtgtagattc cttttacaaa       900
     acacattcat tttgcaaaaa tgaagaccat gagtgaacag ttatttcctg acccatggct       960
     actttgaatc ctttgccaaa gagtgccaat gatgcaaaaa acaatgggag cagtttggct      1020
     cttaggtaga agcaccctgg tctgaggggt gtgcaagctg agttcttttg tgcatggcat      1080
     agggagacga cggtgtcact gcttagtgtt gggttgggtt ctaagttgtt ttacactgaa      1140
     atcagacttc atgtttaatg ccattaggcg tcaacgtaaa gagacttgta aaaatattaa      1200
     aggtatatcg ttaattctgt atctgttgct tgtcctttgt agacagttat gttaggacca      1260
     taggcagtgc agctgccaag ttatttttaa accatctaaa aggagagtgc tatttaaaca      1320
     tctgtcttaa actgtcctga gcttctactt ttcttccatt tacccccttt gggagaacat      1380
     tctagttggt aagtttatta cctttcaaaa tgtgcttggc acctgcctta aatagcacga      1440
     acatattgtg cacatcttta aattaattta actggcaaaa aaacaattac attttaaact      1500
     aaaactgaga ctgagaacag tacccaatct gtcttttaaa gcttataaaa gtgaatcggg      1560
     tacaattagc aaaaagaaga aagaagacac tgaatttatg acgttttaca gtaatgaagc      1620
     tatactttgg tctttcttcc aagaactgcg atttttctct gtatgaatta taacttagtc      1680
     tgtgttggaa ctttgaattg tgtaatatac acattaaacc atctaaattg aagccattct      1740
     tctaaaggaa ggactgctac tttgacagta cttgatccag atttctaaag aaaatgtttt      1800
     tgttttgttg tgtttttggt aaataaactg caactttgtc                            1840
//


spacer
spacer