spacer

EBI Dbfetch

ID   AK083821; SV 1; linear; mRNA; HTC; MUS; 2416 BP.
XX
AC   AK083821;
XX
DT   19-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus 12 days embryo spinal ganglion cDNA, RIKEN full-length
DE   enriched library, clone:D130015G23 product:valosin containing protein, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2416
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 58f2df89e40571fff03ebf83d02fdcf6.
DR   Ensembl-Gn; ENSMUSG00000028452; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030164; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=D130015G23
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2416
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="12 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="D130015G23"
FT                   /tissue_type="spinal ganglion"
FT                   /db_xref="taxon:10090"
FT   CDS             85..2256
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="valosin containing protein (MGD|MGI:99919
FT                   GB|NM_009503, evidence: BLASTN, 99%, match=2416)"
FT                   /db_xref="GOA:Q8BNF8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR015415"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="MGI:MGI:99919"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BNF8"
FT                   /protein_id="BAC39028.1"
FT                   /translation="MNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITG
FT                   NLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGE
FT                   PIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGP
FT                   PGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDE
FT                   LDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFD
FT                   REVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAI
FT                   RKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGL
FT                   EDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFIS
FT                   IKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRV
FT                   INQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKA
FT                   NLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPS
FT                   AMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTLQQSRGFGSFRFPSGN
FT                   QGGAGPSQGSGGGTGGSVYTEDNDDDLYG"
XX
SQ   Sequence 2416 BP; 621 A; 528 C; 671 G; 596 T; 0 other;
     acggtgttgc taaaaggaaa gaaaagacgg gaagctgtat gcattgttct ttctgatgac        60
     acgtgttctg atgagaagat tcgaatgaat agagttgttc ggaataacct ccgagttcgc       120
     ctaggagatg tcatcagcat ccagccatgc cctgatgtaa agtatggcaa acgtatccac       180
     gttctaccca tcgatgacac agtggaaggc atcactggca atctctttga ggtatacctt       240
     aagccgtact tcctggaagc ttatcggccc atccgtaaag gagatatttt tcttgtccgg       300
     ggtgggatgc gtgctgtgga gttcaaagtt gtagagacag atcccagccc ttactgtatt       360
     gttgctccag acacagtgat ccactgtgag ggggagccaa tcaagcgaga ggatgaggag       420
     gaatccttga atgaagtagg ctatgatgac atcggtggtt gcaggaagca gctagctcag       480
     ataaaggaga tggtggagct gccactgaga catcctgcgc tctttaaggc gattggtgta       540
     aagcctcctc ggggaatctt gttgtatggg cctcctggga cagggaagac cctgattgct       600
     cgagctgtgg caaatgaaac tggagccttc ttctttctga tcaatggtcc tgaaatcatg       660
     agcaaattgg ctggtgagtc tgagagcaac cttcgtaaag cctttgagga agctgaaaag       720
     aatgctcctg ctatcatctt catcgatgag cttgatgcca ttgcacccaa aagagagaaa       780
     actcatgggg aagtggagcg tcgcatcgtg tctcagttgt tgaccctcat ggatggccta       840
     aagcagagag cacatgtgat agttatggca gcaaccaata gacccaacag cattgaccca       900
     gccctacggc gatttggtcg ctttgacaga gaggtagata ttggaatacc tgatgctaca       960
     ggacgtttgg agattcttca gatccatacc aagaacatga aactggcaga tgatgtggac      1020
     ttggaacagg tagccaatga gactcatggt catgttggtg ctgatttggc agccctatgt      1080
     tcagaggctg ctctgcaggc catccggaaa aaaatggacc tcattgacct agaagatgag      1140
     accattgatg ctgaggtcat gaattccctg gcagttacta tggatgactt ccggtgggct      1200
     ttgagtcaaa gcaacccatc agcacttcgg gaaactgtgg tagaggtgcc acaagtaacc      1260
     tgggaagata ttggaggcct ggaggatgtc aaacgtgagc ttcaggagtt ggttcagtat      1320
     cctgtggaac atccagacaa attcctcaaa tttggcatga ctccctccaa aggcgttctt      1380
     ttctatggac ctcctggctg tgggaaaacc ttactggcta aagccattgc taatgaatgc      1440
     caggccaact tcatctccat caagggtcct gagctgctta ccatgtggtt tggggaatct      1500
     gaggccaatg tccgggaaat ttttgacaag gcacggcaag ctgccccctg tgtactcttc      1560
     tttgatgagt tagattcaat tgccaaggct cgaggtggta atattggaga tggtggtgga      1620
     gctgctgacc gagtcatcaa tcagatcctg acagaaatgg atggcatgtc tacaaaaaag      1680
     aatgtgttta tcattggagc taccaacagg cctgacatca ttgatcctgc tatcctaaga      1740
     cctggccgtc tagatcagct catttatatc ccacttcctg atgagaagtc ccgtgttgcc      1800
     atcctaaaag ccaatctgcg aaagtcccca gttgccaagg atgtggattt ggagttcctg      1860
     gctaagatga ctaatggctt ttctggagct gatttgacag aaatttgcca acgggcttgt      1920
     aaactggcca ttcgtgaatc tattgagagt gagattaggc gagaacgaga gaggcagaca      1980
     aatccatcgg ctatggaggt agaagaggac gatccagtgc ctgagatccg cagagatcac      2040
     tttgaggaag ccatgcgttt tgcccgacgt tctgtcagcg ataatgacat tcggaagtat      2100
     gaaatgttcg cccagacact gcagcagagt cgaggttttg gcagcttcag attcccttca      2160
     gggaaccagg gtggagctgg tcccagccag ggcagtggag gtggcacagg tggcagtgtg      2220
     tacacagaag acaatgacga tgacctgtat ggctaagtga tgtgccagca tgcagcgagc      2280
     tggcctggct ggaccttgtt ccctggggga gggggcgctt gcccaagagg gaccaggggt      2340
     gtgcccatgg cctgttccat tcctcagtct gaacagttca gccccagtca gactctggac      2400
     aggggtttcc tgttgc                                                      2416
//


spacer
spacer