spacer

EBI Dbfetch

ID   AK083478; SV 1; linear; mRNA; HTC; MUS; 4122 BP.
XX
AC   AK083478;
XX
DT   19-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 9 days embryo whole body cDNA, RIKEN full-length enriched
DE   library, clone:D030025E18 product:solute carrier family 11 (proton-coupled
DE   divalent metal ion transporters), member 2, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4122
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; f09446ca9c17cbfe9e003f0c1957ff19.
DR   Ensembl-Gn; ENSMUSG00000023030; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023774; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000138843; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=D030025E18
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4122
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="9 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="D030025E18"
FT                   /tissue_type="whole body"
FT                   /db_xref="taxon:10090"
FT   CDS             79..1764
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="solute carrier family 11 (proton-coupled divalent
FT                   metal ion transporters), member 2 (MGD|MGI:1345279
FT                   GB|NM_008732, evidence: BLASTN, 99%, match=1689)"
FT                   /db_xref="GOA:P49282"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="MGI:MGI:1345279"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49282"
FT                   /protein_id="BAC38930.1"
FT                   /translation="MVLDPKEKMPDDGASGDHGDSASLGAINPAYSNSSLPHSTGDSEE
FT                   PFTTYFDEKIPIPEEEYSCFSFRKLWAFTGPGFLMSIAYLDPGNIESDLQSGAVAGFKL
FT                   LWVLLLATIVGLLLQRLAARLGVVTGLHLAEVCHRQYRKVPRIILWLMVELAIIGSDMQ
FT                   EVIGSAIAINLLSAGRVPLWGGVLITIADTFVFLFLDKYGLRKLEAFFGFLITIMALTF
FT                   GYEYITVKPSQSQVLRGMFVPSCPGCRTPQVEQAVGIVGAVIMPHNMYLHSALVKSRQV
FT                   NRANKQEVREANKYFFIESCIALFVSFIINVFVVSVFAEAFFEKTNKQVVEVCKNNSSP
FT                   HADLFPSDNSTLAVDIYKGGVVLGCYFGPAALYIWAVGILAAGQSSTMTGTYSGQFVME
FT                   GFLNLKWSRFARVILTRSIAIIPTLLVAVFQDVEHLTGMNDFLNVLQSLQLPFALIPIL
FT                   TFTSLRPVMSEFSNGIGWRIAGGILVLIVCSINMYFVVVYVQELGHVALYVVAAVVSVA
FT                   YLTFVFYLGWQCLIALGLSFLDCGRSVSISKVLLSEDTSGGNIK"
XX
SQ   Sequence 4122 BP; 888 A; 1029 C; 1057 G; 1148 T; 0 other;
     gggagtcgcc ggcgcggcgt gtgtggaggt ggcggagccg aatcctattc taagagcaca        60
     gaccctcagg tatctaccat ggtgttggat cctaaagaaa agatgccaga cgatggcgct       120
     tctggggacc atggagactc tgccagcctt ggcgccatca accctgccta cagcaactca       180
     tccctcccac attccactgg agactctgag gagcccttca ccacctactt tgatgagaaa       240
     atccccattc ctgaggagga gtactcttgt tttagctttc gtaaactctg ggcgttcacg       300
     gggcctggct ttcttatgag cattgcctac ctagacccag gaaacatcga atctgatttg       360
     cagtctggag cagtggctgg atttaagctg ctctgggtgc tcctcttggc caccattgtg       420
     gggctgctgc tccagcgcct tgcagcgaga cttggagtgg tcaccggctt gcatcttgct       480
     gaagtatgtc accgtcagta tcgcaaggtc ccacggatca tcctgtggct gatggtggag       540
     ttggcaatca ttggttctga catgcaggaa gtcattggct cagccatcgc catcaatctc       600
     ctgtctgcag gaagggtccc cctgtggggc ggagtcctca tcaccatcgc agacactttt       660
     gtgtttcttt ttttggacaa atatggcttg cggaagctgg aagcgttttt tggctttctc       720
     atcactatca tggccctcac gtttggatat gagtacatta cagtgaagcc cagccagagc       780
     caagtactca ggggcatgtt cgtgccgtcc tgtccagggt gccgcacccc tcaggtggag       840
     caggcggtgg gcatcgtggg agctgtgatc atgccgcaca acatgtacct gcattctgcc       900
     ttagtcaagt ctagacaggt gaatcgggcc aataagcagg aagtgcggga agccaataag       960
     tacttcttca tcgagtcctg catcgcgctc tttgtttcct tcatcatcaa tgtctttgtc      1020
     gtgtccgtct ttgctgaagc attttttgag aaaaccaaca agcaggtggt tgaagtctgc      1080
     aaaaataaca gcagccccca tgctgacctc tttcccagtg acaactctac tctggctgtg      1140
     gacatctaca aagggggtgt tgtgcttgga tgttacttcg ggcctgcagc tctctacatc      1200
     tgggcagtgg ggatcctggc tgccggtcag agctccacca tgactggaac ctattctggc      1260
     cagtttgtca tggagggatt cctgaaccta aaatggtcgc gctttgcccg agtgatcctg      1320
     acccggtcta tcgccatcat ccccaccctg ctcgtcgctg tcttccagga tgtggagcac      1380
     ctaacgggga tgaatgactt cctgaatgtc ctgcagagct tacagctccc ctttgctctc      1440
     atacccatcc tcacgttcac aagcctgcgg ccagtgatga gtgagttttc caatggaata      1500
     ggctggagga ttgccggtgg catcctggtc ctgatcgtct gctccatcaa catgtacttt      1560
     gtagtggttt atgtccagga gctagggcat gtggcactct atgtggtggc tgcagtggtt      1620
     agcgtggctt atttgacctt tgtgttctac ttgggttggc agtgtttgat tgcattgggt      1680
     ctgtctttcc tggactgtgg acgctcggta agcatctcga aagtcctgct gagcgaagat      1740
     accagcggtg gcaacattaa gtaaacactg gatcagtctg tctgtctttg cagggagcca      1800
     tcagagccag tgtgtttcta tggtttactg tgtgaacata gccacaagta tgtgctgttg      1860
     cacagactgc atttaggact caactgttag ttgggaaaca ctgatgtgtg tgtgtgtgtg      1920
     tgtgtatatg tgtgtgtgtg tgtgtgttaa ggtctttgtt tccttttgtt tttgtgaaat      1980
     agcatcttgc tattaaatac taggttgcct aaaactcact atgtagctta ggctgtgctc      2040
     aaacctacag caatccttct gacctaagct cctgagtgct gggattccag gcacgtctac      2100
     catgcctggc tctcatgtat gcttaagatg agttttgttg ggggtcaggg tggggggtag      2160
     ggggtcttac cctgtagcat taggcagcac cttgaaaagg tggcccttga gctgttttaa      2220
     acactaagtt tctaaatagc tgcccaaggg cagtagcttg tttttagtca aaagaaacgc      2280
     aaccagactg tcgccatcct tgaattatag aatgagactg ctgcctttga agtcagggtt      2340
     tttgtttggt gcattttgtt tgtttttcaa gagttttttc gtggctgtcc tggaacttac      2400
     tctgtagacc aggatggctt cgaactcaca gagatcctcc tgcctctgcc tctgcctcta      2460
     cctcccgagt gctaggatta gaggcagaca cctccactgc cctgctggtt caggattttt      2520
     ttttttttta tttctacttc ggaatttctc agtggaaaga aaaaaaaggt agggcataag      2580
     tggtgggtgt ggacagatga tggctcacct gcagtgcagg ttttccttaa ggaatggagc      2640
     ttagcaggga gggcttcatc tttagccctg aggttagtaa cttccctgct aatatcaagc      2700
     cttcctgata tgttgaatct tgagcacaca cagtccctga atctttctct tctgagagag      2760
     tgctgcctgc agaagactgt agcactcgtg gactgacttt tatgaggctc tggactcgga      2820
     acgagtcaca gagctaactg cactactccc aaaagtaccc ttcaccaaat catgtctctg      2880
     gcgctgccat tccacgccca agataactca gaaggcaatc tcaggagctc tggacccaaa      2940
     ccttgcaaag tcagtaggtg tcactggtgt gaagtcctct cccggcaagg tgggcctggg      3000
     ctgtatccta acagcccttc ctcggagaga aagcctgctg aggccagact gcgaagctct      3060
     ggagtcttca gcaccgaact gctgccctca gttcagctac ttctgacctg tcacggggga      3120
     gacgtgattc tgtcacatca aatgctgtct gtctgctgga gaggagtgac acaagagtgt      3180
     gtgatcattg tcttggtggc agcgggagct agagctgctt cgaaggatgt cctctctgac      3240
     gctttccctg tggcgagcgg gccgacaaat ggcctttgct gtctgtgcct ctgtagcgct      3300
     cctgctagca tttctcacag tcagaggctc agcctgcata gatctttatg aggcatacat      3360
     tatcaatcgc tgtgtttcac tcacccacag ctaatccaac aaaaccaggt cacgggtccc      3420
     tcccagcagc attcccaacc tgtggttgcc acccatctgc aaccctatat tcgaagacat      3480
     ttacctcatg atttgtaaca gtagcaagat tagttacaaa gtagcaaaat tattattggg      3540
     tgtgaccccc agcatgagga gctgacttaa aagagtggca gcttccggaa ggtggggaac      3600
     ccctgcacta cagggtcctc ctcccccctg cccccctccc ccactgttcc cgaaggctag      3660
     aagctgagct tttgaacctg tgcagtgctt gagggccagg ctgacggcag cagaattcct      3720
     tgcatagatg ctctagtgat gtctgcattt gtacagggat ggggtggggc gagcagagtg      3780
     tatccagatt cgccatactt aaagagtcca gcctgaagct gcttgggatc gcgcccaggg      3840
     ctctgcctcg tgtgttctag gcaaggctcc gttgcacatc tcacttcctg ccccagaatt      3900
     ctgttgtgtt atacttgttt acaatgatag aaggtttcgt tgtgtgatac ggtctcttct      3960
     gactctctga ctacaatatt tacagtgtca aaagattaaa aatgttccct attcacttga      4020
     ttgtcactga aaacggtact tcaacagtac agtaacctgt aaacatttca cgccccccac      4080
     gcaactctgc taccggcatt atatttgtga gccatctttg tg                         4122
//


spacer
spacer