Dbfetch

ID   AK083288; SV 1; linear; mRNA; HTC; MUS; 1471 BP.
XX
AC   AK083288;
XX
DT   19-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 13)
XX
DE   Mus musculus adult male liver tumor cDNA, RIKEN full-length enriched
DE   library, clone:C730009K20 product:solute carrier family 39 (iron-regulated
DE   transporter), member 1, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1471
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; cb05d470a569f3d79444937df9873ed2.
DR   Ensembl-Gn; ENSMUSG00000025993; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0015996; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0015980; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0015935; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0015934; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015767; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016387; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015349; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0015739; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0015840; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0015842; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0015910; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015862; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016434; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015133; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015410; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000027137; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0019694; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0019671; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0019628; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0019620; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0019449; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020119; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0018956; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0019403; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0019517; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0019523; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0019605; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0019493; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020173; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0018713; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019044; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C730009K20
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1471
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C730009K20"
FT                   /cell_type="tumor"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..246
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="solute carrier family 39 (iron-regulated
FT                   transporter), member 1 (MGD|MGI:1315204 GB|NM_016917,
FT                   evidence: BLASTN, 98%, match=1471)"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q9JHI9"
FT                   /db_xref="InterPro:IPR009716"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:1315204"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JHI9"
FT                   /protein_id="BAC38844.1"
FT                   /translation="IINGVQNSMNYLLDLLHFIMVILAPNPEAFGLLVLISVSFVAMGH
FT                   LMYFRFAQKTLGNQIFVCGPDEKEVTDENQPNTSVV"
XX
SQ   Sequence 1471 BP; 438 A; 262 C; 284 G; 487 T; 0 other;
     attatcaatg gtgtgcagaa ctccatgaac taccttcttg accttctgca tttcatcatg        60
     gtcatcttgg ccccaaatcc tgaagctttt ggcttgctgg tattgatttc agtctccttt       120
     gtggcaatgg gacatcttat gtatttccga tttgcccaga agactctggg caaccagatt       180
     tttgtttgtg gtcctgatga aaaagaagtt acagatgaaa atcaaccgaa tacatctgtt       240
     gtataaaaat agtttagctg tggcccctgt tactagattg tggagagcat gtgtgcttat       300
     tttgtactgc agaatcccaa taaatgcctg catttctctc tggttttacc acatctgtgc       360
     cttaagggct aggagcacta actaaccatc gccagcaaag atggttattt ctccttacat       420
     gtaaacattg gaaaatagga agagggagag gcagtcagcg tgtgtatagg aagggtttaa       480
     tggtaaaatg aacttccctt actcttatga gtatattaaa ttttaaagag tggttgtcag       540
     gtgagtaaaa ttattcctta gcagatattt attatctact ggaatgataa atcaattcac       600
     cctaaaactc actcttgtaa aactctgctc cacttccttt ttttaagatc agtgatattt       660
     ttctcagtta cattacagaa acaagttttt cctccatgta tgaaggttat agttagataa       720
     tgaatgttat ccttattaat cccattgaac ttaaggaatt tattgtatgt ggaggatgaa       780
     atgtgtaact agacttgtcc aaaaggttca tggaataact tttgcatttt gaccatcaga       840
     aagggcaaaa tattacagta atgtgtgtat ggtggctctt cataaaatga ctctcaaaat       900
     ctgcagaaag aagaaaagtt gtaggtttct agtgtggtac agaaggactt aaagcttgtt       960
     attagtgtga ttgtagaaac tggaagctaa gggtgaggac ctcatgtaac cagagtcact      1020
     gtcatcagcc atcactaact attttggtaa atgagagaac tgacctggca ccttacaagc      1080
     agaaaagcgg cccacactaa gaaaggactg caaatcagtg agtctgtata gaacatttta      1140
     ccttcactga cttgggccga tgtgtttgtc atctctgtgt ttttctagag caagaatagt      1200
     cacaaaagtt cccctttcaa tatccctgag aagaataaag aaaaaactgt ttgtaaatat      1260
     ttttttaaaa ctgttctgca agtctttttg taacatgcag taccaacatg ggacattgcc      1320
     ttaacttttg atgcactttc atggagactg actgccatgc attgctgtga gcactttctt      1380
     tgtcgttcag tttaatcttt tccttcacct ttattacagt atgacataat gatctactat      1440
     gttgtcaaag cttcataaaa tatttctata t                                     1471
//