spacer

EBI Dbfetch

ID   AK083168; SV 1; linear; mRNA; HTC; MUS; 2690 BP.
XX
AC   AK083168;
XX
DT   19-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 16)
XX
DE   Mus musculus adult male hippocampus cDNA, RIKEN full-length enriched
DE   library, clone:C630023F22 product:UDP-Gal:betaGlcNAc beta
DE   1,3-galactosyltransferase, polypeptide 2, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2690
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; df005cab64b7fd3bd7ae911ed3cab7ad.
DR   Ensembl-Gn; ENSMUSG00000033849; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038252; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C630023F22
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2690
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C630023F22"
FT                   /tissue_type="hippocampus"
FT                   /db_xref="taxon:10090"
FT   CDS             724..1992
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase,
FT                   polypeptide 2 (MGD|MGI:1349461 GB|NM_020025, evidence:
FT                   BLASTN, 99%, match=1269)"
FT                   /note="putative"
FT                   /db_xref="GOA:O54905"
FT                   /db_xref="InterPro:IPR002659"
FT                   /db_xref="MGI:MGI:1349461"
FT                   /db_xref="UniProtKB/Swiss-Prot:O54905"
FT                   /protein_id="BAC38793.1"
FT                   /translation="MLQWRRRHCCFAKMTWSPKRSLLRTPLTGVLSLVFLFAMFLFFNH
FT                   HDWLPGRPGFKENPVTYTFRGFRSTKSETNHSSLRTIWKEVAPQTLRPHTASNSSNTEL
FT                   SPQGVTGLQNTLSANGSIYNEKGTGHPNSYHFKYIINEPEKCQEKSPFLILLIAAEPGQ
FT                   IEARRAIRQTWGNETLAPGIQIIRVFLLGISIKLNGYLQHAIQEESRQYHDIIQQEYLD
FT                   TYYNLTIKTLMGMNWVATYCPHTPYVMKTDSDMFVNTEYLIHKLLKPDLPPRHNYFTGY
FT                   LMRGYAPNRNKDSKWYMPPDLYPSERYPVFCSGTGYVFSGDLAEKIFKVSLGIRRLHLE
FT                   DVYVGICLAKLRVDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQ
FT                   NKHNACANAAKEKAGRYRHRKLH"
FT   polyA_signal    2671..2676
FT                   /note="putative"
FT   polyA_site      2690
FT                   /note="putative"
XX
SQ   Sequence 2690 BP; 917 A; 526 C; 509 G; 738 T; 0 other;
     gaaactgctg cctgcctgtg cagcacggaa gaacggtgca tttcacatta cagaccaaaa        60
     ccccaggaaa acagctcaaa aatccttcct gcagctgcca ggcaaccacg acggagaaag       120
     gcaaagcctt tttttttccc ccaatgcaac tgaaacacta aaccacagct ctgctgctta       180
     acattgcagc tcagcgctat tactagaaat atggatactg agaagagaat acagcactgc       240
     attgtccagc cgggaataca gcagatgtaa agagcttcaa tgcatcaact gtcggaaaga       300
     gtcaactgtg caccaaatac aacagacagc tacagctctt ttgtttagtg aaagagagaa       360
     aatgaaagaa aggaaaaatc tctgaagact ataagatata gacatatgaa caagaagggt       420
     aacttgaaga caccccgaca gatggacact ttggatactg tgaaaagcaa tcacaggagg       480
     cagactgttg ggggatgtgc gcatgttcga tagcatcgtt ttttgctgaa gtgatggcgt       540
     gccaaaagta ttttcagtag acataatcct ctccatctaa tggtctgacc aagaaagaaa       600
     gaatgacatc gagggacatg tacctgaacc agaagacgat gaatcaagcg cagtattgac       660
     tgaggacgga acaacagtgt ttttggccac agacatccat tactgctact ggatacttac       720
     aacatgcttc agtggagaag acgacactgc tgctttgcaa aaatgacctg gagccctaag       780
     aggtctctgc tccggactcc ccttacgggt gtgctttctc tagtgtttct ctttgctatg       840
     ttcttgtttt tcaatcatca tgactggtta ccaggtagac caggattcaa agaaaatcct       900
     gtgacataca ctttccgagg atttcgttct acaaaaagtg agacaaacca tagctccctt       960
     cggaccatct ggaaagaagt agctcctcag actctgaggc ctcacacagc aagcaactcc      1020
     agtaacaccg agctatcacc acagggagtc acagggctgc agaacactct cagtgccaat      1080
     ggcagcattt ataatgaaaa aggaactgga catccaaact cttaccattt caaatatatt      1140
     atcaatgagc ctgaaaaatg ccaagagaaa agtccatttt taatactatt aatagctgca      1200
     gaacctggac aaatcgaagc aagaagagct atacggcaaa cttggggcaa tgaaactttg      1260
     gcacctggca tccaaatcat acgggttttt ttgttgggca taagtattaa gctaaatggc      1320
     tatcttcaac atgcaattca agaagaaagc agacagtatc atgatataat tcagcaggaa      1380
     tatttagata catactataa tctgaccatt aaaacactaa tgggtatgaa ctgggttgca      1440
     acatactgtc cacatactcc ctatgttatg aaaacggaca gtgacatgtt tgtcaacaca      1500
     gaatacttaa tacacaagtt actaaagcca gacctgcctc ctagacataa ctattttact      1560
     ggctatctaa tgagaggata tgcaccgaac agaaacaaag acagtaagtg gtacatgcca      1620
     ccagaccttt acccaagtga gcgctaccct gtcttctgct caggaactgg ttatgtgttt      1680
     tctggggatc tggcagagaa gatatttaag gtttctttag gtatccgtcg tttgcacttg      1740
     gaagatgtat atgtagggat ctgtcttgcc aagttgagag ttgatcctgt gccccctccc      1800
     aatgagttcg tgttcaatca ctggcgagtt tcttattcaa gctgtaaata cagccaccta      1860
     attacctctc atcagttcca acctagtgaa ctgataaaat actggaacca tttacaacaa      1920
     aataagcaca acgcctgtgc caatgcagca aaggaaaagg caggcaggta tcgacaccgc      1980
     aaactacact agaagactat ttttgttcaa atgtggagtc tgtaaatatt gcttaaagca      2040
     tgtatagtta aaaacttgat tatatacata ggacaagttt tagttcaact catcacataa      2100
     aggaattcaa agctattttt taaattttct gaataagata attcatacaa ttgcaaatta      2160
     tgacaaaaag gtatcccaaa agagtctatt taaataactg ttatgaggag attctctata      2220
     ttaacatgca ataataagca tgcatacata aatggttcaa gacttacatt agggaccaat      2280
     acaatgtatc tgcatacatt ttctatataa atcttaagaa atgaaggcag taaaaagatt      2340
     cctagattta cttttgattt catcatataa ctaaatgtaa ataagacagt actattgatt      2400
     ttaaaggaac tttgtaattg tgcaatgaac aagttttctg acctgactca gttgcaataa      2460
     gatttagtta agttattcca taaactcatt tatagcattc aggtgtttga gcaatgcaat      2520
     tctcattcaa gaatatactt ttaaaaataa tttataatta ttttaatttc ttttattaat      2580
     acttatctat actgggaaaa ttattttgac atgatgtgat aaatgtgaaa aattaatgtg      2640
     tctcaggctc aagtttttat aaaatgaatt attaaaggta tcaaaatagt                 2690
//


spacer
spacer