Dbfetch

ID   AK082753; SV 1; linear; mRNA; HTC; MUS; 1594 BP.
XX
AC   AK082753;
XX
DT   13-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus ES cells cDNA, RIKEN full-length enriched library,
DE   clone:C330004J02 product:myotubularin related protein 1, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1594
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-APR-2002) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; a832a576dcda7845158599c66f5ca1b7.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C330004J02
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1594
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C330004J02"
FT                   /cell_type="ES cells"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..366
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="myotubularin related protein 1 (MGD|MGI:1858271
FT                   GB|NM_016985, evidence: BLASTN, 99%, match=1594)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q8C489"
FT                   /db_xref="InterPro:IPR010569"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR030564"
FT                   /db_xref="InterPro:IPR030587"
FT                   /db_xref="MGI:MGI:1858271"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C489"
FT                   /protein_id="BAC38603.1"
FT                   /translation="CEQQRIKEDVYTNTISLWSYINSQLDEFSNPFFVNYENHVLYPVA
FT                   SMSHLELWVNYYVRWNPRMRPQMPIHQNLKELLAIKAELQKRVEDLQREMATRTISSSS
FT                   ERGSSPTHSATPVHTSV"
XX
SQ   Sequence 1594 BP; 424 A; 355 C; 321 G; 494 T; 0 other;
     tgtgaacaac agcgaatcaa agaggatgta tatacaaata ctatatcttt atggtcttat        60
     atcaatagcc aactagatga attctcaaat cccttctttg tgaattatga gaaccatgtg       120
     ttatatcctg ttgctagtat gagtcacttg gaattgtggg taaattatta tgtacggtgg       180
     aatccacgga tgagaccaca gatgccaatt catcagaatc tcaaggaact gctggctatc       240
     aaggctgagc tgcagaagcg tgtggaggac ttgcagcggg agatggccac ccggaccatc       300
     tcatcttcct ctgagagggg ctcctcacct acccactcag ctactcctgt acacacctca       360
     gtctgatgaa caaagccagt accccgggcc atccggctgc tctattgtct tccagcagct       420
     cggggacctg gccattgata ttatggttct agcttgtcat cttagctctt aggactcagc       480
     ccagggacca tttgtgggtg gtgaaagctc ctattattaa caagtacttc ttttgtgtga       540
     acagcctgtg ccccttttgc gagcagcctc accctgtgaa ccacctgtgt cttgtacagg       600
     tagcttggga gaaaccagat tgaatgcagt gcggtatttt aacttaagag aatcttacac       660
     cacttctttc caagttacat cctttgttac gaacaactcg tttacttata gaacacatca       720
     ccagccatgt ggctcctctc agccttttgg cacaatttaa aaactgtttt aaatgaaatg       780
     ttagtgtggc aaatgaacca ttgccacctg ttctacagtt atcagttatc ttcatacaag       840
     aagtcctgtt caactggtac aatatgtact gctgtgtaca tataaggtat tttttaaaga       900
     gaaacatgcc tttattttcc tatgtccttt tttatgttta gaaaagcctg agaaatcatc       960
     tgctaaactg tgctgtagga gaaattcttt cccaacggag tccatgctgc cttttgcgca      1020
     gcacatttga attaagattc gagatgtgtc agctcagtgg caatggagtg ttgtcctcta      1080
     actctggtac ttgtcttttg agatggcaca gcccattcat tcattggtgg tagcagcagg      1140
     ttccctcagg atgcagcaaa ctatgaatgc tcagtcctct ggccttgtcg caggtaaact      1200
     gagggctcag gcagcaactc tgcatttgtt ggcctccctc tatgacagct ctctaaagga      1260
     gcaagtcttg aaaattgctt tggcatccta ccacctgtta agatgcccag catctatgtc      1320
     aaatcaagtc gtctctcacc tgttagacac ctggacagct tgctttcatt taccacgatc      1380
     tcttctcagt tgatttacat gactgcctgg ccatacttta aggcaaccag tggctaaaat      1440
     actcatgaaa ttaaatatca gtgattgcac tgaactgtat acttcagatg agctaatttt      1500
     actacgttaa tttagcattt atttaagtgg agaattaatt agttttgtat tccctatttt      1560
     acaaaaattg ataaagatat agttcatgga tttt                                  1594
//